Grouped product items

SKU

Size

Availability

Price

Qty

rp169548-10μg (Trial Size)
Apply for free trial size（?）

10μg

In stock

$99.90

rp169548-100μg

100μg

In stock

$499.90

rp169548-1mg

1mg

Available within 8-12 weeks(?)

$2,399.90

Basic Description

Product Name	Recombinant Human Kallikrein 3/PSA Protein, >95% (SDS-PAGE), high purity
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： KLK3 (Kallikrein Related Peptidase 3) is a Protein Coding gene. The gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. It encodes a single-chain glycoprotein, a protease that is synthesized in the epithelial cells of the prostate gland and is present in seminal plasma. KLK3, also known as Prostate Specific Antigen (PSA), kallikrein-related peptidase 3, Gamma-seminoprotein, is a secreted protein of the glandular kallikrein subfamily of serine proteases. KLK3 contains one peptidase S1 domain. KLK3 is a glycoprotein produced almost exclusively by the prostate gland. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized human Kallikrein 3/PSA (rp169548) at 1 μg/mL can bind PSA Mouse mAb (Ab005494) with the EC50 of 78.61 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	18-261 aa
Sequence	APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPHHHHHHHHHH
Protein Tag	C-His
N-terminal Sequence	Ala18
Predicted molecular weight	28.2 kDa
SDS-PAGE	33.8 kDa, under reducing conditions; 30.3 kDa, under non-reducing conditions

Images

Recombinant Human Kallikrein 3/PSA Protein (rp169548) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human Kallikrein 3/PSA (rp169548) at 1 μg/mL can bind PSA Mouse mAb (Ab005494) with the EC₅₀ of 78.61 ng/mL.

Recombinant Human Kallikrein 3/PSA Protein (rp169548) - SDS-PAGE
3 μg/lane of Recombinant Human Kallikrein 3/PSA Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 33.8 kDa under reducing conditions and 30.3 kDa under non-reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

2 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0102692	Certificate of Analysis	Feb 06, 2024	rp169548
ZJ24F0102693	Certificate of Analysis	Feb 06, 2024	rp169548

References

1. Kostova MB, Rosen DM, Chen Y, Mease RC, Denmeade SR. (2013) Structural optimization, biological evaluation, and application of peptidomimetic prostate specific antigen inhibitors.. J Med Chem, 56 (11): (4224-35). [PMID:23692593]
2. De Vita E, Schüler P, Lovell S, Lohbeck J, Kullmann S, Rabinovich E, Sananes A, Heßling B, Hamon V, Papo N et al.. (2018) Depsipeptides Featuring a Neutral P1 Are Potent Inhibitors of Kallikrein-Related Peptidase 6 with On-Target Cellular Activity.. J Med Chem, 61 (19): (8859-8874). [PMID:30212625]
3. LeBeau AM, Banerjee SR, Pomper MG, Mease RC, Denmeade SR.. (2009) Optimization of peptide-based inhibitors of prostate-specific antigen (PSA) as targeted imaging agents for prostate cancer.. Bioorg Med Chem, 17 (14): (4888-4893). [PMID:19541487]
4. Santos JA, Kondo MY, Freitas RF, dos Santos MH, Ramalho TC, Assis DM, Juliano L, Juliano MA, Puzer L.. (2016) The natural flavone fukugetin as a mixed-type inhibitor for human tissue kallikreins.. Bioorg Med Chem Lett, 26 (5): (1485-1489). [PMID:26848109]
5. Wu X, Hu L.. (2016) Design and synthesis of peptide conjugates of phosphoramide mustard as prodrugs activated by prostate-specific antigen.. Bioorg Med Chem, 24 (12): (2697-2706). [PMID:27156193]
6. Akinboye ES, Rosen MD, Bakare O, Denmeade SR.. (2017) Anticancer activities of emetine prodrugs that are proteolytically activated by the prostate specific antigen (PSA) and evaluation of in vivo toxicity of emetine derivatives.. Bioorg Med Chem, 25 (24): (6707-6717). [PMID:29153549]
7. Bakthavatsalam S, Wiangnak P, George DJ, Zhang T, Franz KJ.. (2020) Dithiocarbamate prodrugs activated by prostate specific antigen to target prostate cancer.. Bioorg Med Chem Lett, 30 (11): (127148-127148). [PMID:32253061]
8. Tang Q,Fu W,Zhang M,Wang E,Shan L,Chai X,Pang J,Wang X,Xu X,Xu L,Li D,Sheng R,Hou T. (2020) Novel androgen receptor antagonist identified by structure-based virtual screening, structural optimization, and biological evaluation.. Eur J Med Chem, 192 (112156-112156). [PMID:32114360]
9. España, F F and 5 more authors.. (1991) Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen.. Thrombosis research, (1): [PMID:1725227]
10. Watt, K W KW, Lee, P J PJ, M'Timkulu, T T, Chan, W P WP and Loor, R R.. (1986) Human prostate-specific antigen: structural and functional similarity with serine proteases.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2422647]
11. Lundwall, A A and Lilja, H H.. (1987) Molecular cloning of human prostate specific antigen cDNA.. FEBS letters, (20): [PMID:2436946]
12. Schulz, P P and 5 more authors.. (1988) Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence.. Nucleic acids research, (11): [PMID:2456523]
13. Riegman, P H PH, Vlietstra, R J RJ, van der Korput, J A JA, Romijn, J C JC and Trapman, J J.. (1989) Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene.. Biochemical and biophysical research communications, (28): [PMID:2466464]
14. Digby, M M, Zhang, X Y XY and Richards, R I RI.. (1989) Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1.. Nucleic acids research, (11): [PMID:2467258]
15. Klobeck, H G HG, Combriato, G G, Schulz, P P, Arbusow, V V and Fittler, F F.. (1989) Genomic sequence of human prostate specific antigen (PSA).. Nucleic acids research, (25): [PMID:2471958]
16. and Lundwall, A A.. (1989) Characterization of the gene for prostate-specific antigen, a human glandular kallikrein.. Biochemical and biophysical research communications, (30): [PMID:2472789]
17. Schaller, J J and 5 more authors.. (1987) Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma.. European journal of biochemistry, (30): [PMID:3691515]
18. Monne, M M, Croce, C M CM, Yu, H H and Diamandis, E P EP.. (1994) Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors.. Cancer research, (15): [PMID:7527295]
19. Villoutreix, B O BO, Getzoff, E D ED and Griffin, J H JH.. (1994) A structural model for the prostate disease marker, human prostate-specific antigen.. Protein science : a publication of the Protein Society, [PMID:7535613]
20. Baffa, R R, Moreno, J G JG, Monne, M M, Veronese, M L ML and Gomella, L G LG.. (1996) A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue.. Urology, [PMID:8677566]
21. Coombs, G S GS and 8 more authors.. (1998) Substrate specificity of prostate-specific antigen (PSA).. Chemistry & biology, [PMID:9751643]
22. Gan, L L and 8 more authors.. (2000) Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.. Gene, (17): [PMID:11054574]
23. Ménez, Renée R and 6 more authors.. (2008) Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody.. Journal of molecular biology, (29): [PMID:18187150]
24. Végvári, Akos A and 6 more authors.. (2013) Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring.. Molecular & cellular proteomics : MCP, [PMID:23842001]
25. Henttu, P P and Vihko, P P.. (1989) cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes.. Biochemical and biophysical research communications, (28): [PMID:2470373]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Recombinant Human Kallikrein 3/PSA Protein, >95% (SDS-PAGE), high purity