| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp169548-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $99.90 | |
| rp169548-100μg | 100μg | In stock | $499.90 | |
| rp169548-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,399.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F cell, His tag, 18-261 aa
| Product Name | Recombinant Human Kallikrein 3/PSA Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | EC 3.4.21.77 | Gamma-seminoprotein | Kallikrein-3 | P-30 antigen | PSA | Semenogelase | Seminin | APS seminin | EC 3.4.21 | EC 3.4.21.77 | Gamma-seminoprotein | hK3 | Kallikrein 3 | kallikrein 3, (prostate specific antigen) | Kallikrein-3 | kallikrein-rel |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | >95% (SDS-PAGE) |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized human Kallikrein 3/PSA (rp169548) at 1 μg/mL can bind PSA Mouse mAb (Ab005494) with the EC50 of 78.61 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 18-261 aa |
| Sequence | APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANPHHHHHHHHHH |
| Protein Tag | C-His |
| N-terminal Sequence | Ala18 |
| Predicted molecular weight | 28.2 kDa |
| SDS-PAGE | 33.8 kDa, under reducing conditions; 30.3 kDa, under non-reducing conditions |
Recombinant Human Kallikrein 3/PSA Protein (rp169548) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human Kallikrein 3/PSA (rp169548) at 1 μg/mL can bind PSA Mouse mAb (Ab005494) with the EC₅₀ of 78.61 ng/mL.
Recombinant Human Kallikrein 3/PSA Protein (rp169548) - SDS-PAGE
3 μg/lane of Recombinant Human Kallikrein 3/PSA Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 33.8 kDa under reducing conditions and 30.3 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0102692 | Certificate of Analysis | Feb 06, 2024 | rp169548 |
| ZJ24F0102693 | Certificate of Analysis | Feb 06, 2024 | rp169548 |
| 1. Kostova MB, Rosen DM, Chen Y, Mease RC, Denmeade SR. (2013) Structural optimization, biological evaluation, and application of peptidomimetic prostate specific antigen inhibitors.. J Med Chem, 56 (11): (4224-35). [PMID:23692593] [10.1021/op500134e] |
| 2. De Vita E, Schüler P, Lovell S, Lohbeck J, Kullmann S, Rabinovich E, Sananes A, Heßling B, Hamon V, Papo N et al.. (2018) Depsipeptides Featuring a Neutral P1 Are Potent Inhibitors of Kallikrein-Related Peptidase 6 with On-Target Cellular Activity.. J Med Chem, 61 (19): (8859-8874). [PMID:30212625] [10.1021/op500134e] |
| 3. LeBeau AM, Banerjee SR, Pomper MG, Mease RC, Denmeade SR.. (2009) Optimization of peptide-based inhibitors of prostate-specific antigen (PSA) as targeted imaging agents for prostate cancer.. Bioorg Med Chem, 17 (14): (4888-4893). [PMID:19541487] [10.1016/j.bmc.2009.06.012] |
| 4. Santos JA, Kondo MY, Freitas RF, dos Santos MH, Ramalho TC, Assis DM, Juliano L, Juliano MA, Puzer L.. (2016) The natural flavone fukugetin as a mixed-type inhibitor for human tissue kallikreins.. Bioorg Med Chem Lett, 26 (5): (1485-1489). [PMID:26848109] [10.1016/j.bmcl.2016.01.039] |
| 5. Wu X, Hu L.. (2016) Design and synthesis of peptide conjugates of phosphoramide mustard as prodrugs activated by prostate-specific antigen.. Bioorg Med Chem, 24 (12): (2697-2706). [PMID:27156193] [10.1016/j.bmc.2016.04.035] |
| 6. Akinboye ES, Rosen MD, Bakare O, Denmeade SR.. (2017) Anticancer activities of emetine prodrugs that are proteolytically activated by the prostate specific antigen (PSA) and evaluation of in vivo toxicity of emetine derivatives.. Bioorg Med Chem, 25 (24): (6707-6717). [PMID:29153549] [10.1016/j.bmc.2017.11.015] |
| 7. Bakthavatsalam S, Wiangnak P, George DJ, Zhang T, Franz KJ.. (2020) Dithiocarbamate prodrugs activated by prostate specific antigen to target prostate cancer.. Bioorg Med Chem Lett, 30 (11): (127148-127148). [PMID:32253061] [10.1016/j.bmcl.2020.127148] |
| 8. Tang Q,Fu W,Zhang M,Wang E,Shan L,Chai X,Pang J,Wang X,Xu X,Xu L,Li D,Sheng R,Hou T. (2020) Novel androgen receptor antagonist identified by structure-based virtual screening, structural optimization, and biological evaluation.. Eur J Med Chem, 192 (112156-112156). [PMID:32114360] [10.1016/j.ejmech.2020.112156] |
| 9. España, F F and 5 more authors.. (1991) Functionally active protein C inhibitor/plasminogen activator inhibitor-3 (PCI/PAI-3) is secreted in seminal vesicles, occurs at high concentrations in human seminal plasma and complexes with prostate-specific antigen.. Thrombosis research, (1): [PMID:1725227] |
| 10. Watt, K W KW, Lee, P J PJ, M'Timkulu, T T, Chan, W P WP and Loor, R R.. (1986) Human prostate-specific antigen: structural and functional similarity with serine proteases.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2422647] |
| 11. Lundwall, A A and Lilja, H H.. (1987) Molecular cloning of human prostate specific antigen cDNA.. FEBS letters, (20): [PMID:2436946] |
| 12. Schulz, P P and 5 more authors.. (1988) Sequence of a cDNA clone encompassing the complete mature human prostate specific antigen (PSA) and an unspliced leader sequence.. Nucleic acids research, (11): [PMID:2456523] |
| 13. Riegman, P H PH, Vlietstra, R J RJ, van der Korput, J A JA, Romijn, J C JC and Trapman, J J.. (1989) Characterization of the prostate-specific antigen gene: a novel human kallikrein-like gene.. Biochemical and biophysical research communications, (28): [PMID:2466464] |
| 14. Digby, M M, Zhang, X Y XY and Richards, R I RI.. (1989) Human prostate specific antigen (PSA) gene: structure and linkage to the kallikrein-like gene, hGK-1.. Nucleic acids research, (11): [PMID:2467258] |
| 15. Klobeck, H G HG, Combriato, G G, Schulz, P P, Arbusow, V V and Fittler, F F.. (1989) Genomic sequence of human prostate specific antigen (PSA).. Nucleic acids research, (25): [PMID:2471958] |
| 16. and Lundwall, A A.. (1989) Characterization of the gene for prostate-specific antigen, a human glandular kallikrein.. Biochemical and biophysical research communications, (30): [PMID:2472789] |
| 17. Schaller, J J and 5 more authors.. (1987) Isolation, characterization and amino-acid sequence of gamma-seminoprotein, a glycoprotein from human seminal plasma.. European journal of biochemistry, (30): [PMID:3691515] |
| 18. Monne, M M, Croce, C M CM, Yu, H H and Diamandis, E P EP.. (1994) Molecular characterization of prostate-specific antigen messenger RNA expressed in breast tumors.. Cancer research, (15): [PMID:7527295] |
| 19. Villoutreix, B O BO, Getzoff, E D ED and Griffin, J H JH.. (1994) A structural model for the prostate disease marker, human prostate-specific antigen.. Protein science : a publication of the Protein Society, [PMID:7535613] |
| 20. Baffa, R R, Moreno, J G JG, Monne, M M, Veronese, M L ML and Gomella, L G LG.. (1996) A comparative analysis of prostate-specific antigen gene sequence in benign and malignant prostate tissue.. Urology, [PMID:8677566] |
| 21. Coombs, G S GS and 8 more authors.. (1998) Substrate specificity of prostate-specific antigen (PSA).. Chemistry & biology, [PMID:9751643] |
| 22. Gan, L L and 8 more authors.. (2000) Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region.. Gene, (17): [PMID:11054574] |
| 23. Ménez, Renée R and 6 more authors.. (2008) Crystal structure of a ternary complex between human prostate-specific antigen, its substrate acyl intermediate and an activating antibody.. Journal of molecular biology, (29): [PMID:18187150] |
| 24. Végvári, Akos A and 6 more authors.. (2013) Identification of a novel proteoform of prostate specific antigen (SNP-L132I) in clinical samples by multiple reaction monitoring.. Molecular & cellular proteomics : MCP, [PMID:23842001] |
| 25. Henttu, P P and Vihko, P P.. (1989) cDNA coding for the entire human prostate specific antigen shows high homologies to the human tissue kallikrein genes.. Biochemical and biophysical research communications, (28): [PMID:2470373] |
