| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148028-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp148028-25μg | 25μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $299.90 | |
| rp148028-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $499.90 | |
| rp148028-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $799.90 | |
| rp148028-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,399.90 |
Animal Free, >95% SDS-PAGE, Active, E.coli, No tag, 32-194aa
| Product Name | Recombinant Human KGF/FGF-7 Protein, ＞95% SDS-PAGE, high purity |
|---|---|
| Synonyms | FGF7; FGF-7; fibroblast growth factor 7; HBGF-7; HBGF7; HBGF-7; Heparin-binding growth factor 7; keratinocyte growth factor; KGF; fibroblast growth factor 7 (keratinocyte growth factor) |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95% SDS-PAGE |
| Bioactivity | Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cell. The ED₅₀ for this effect is typically <1.38 ng/mL |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 32-194 aa |
| Sequence | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDK RGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKK ECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKK EQKTAHFLPMAIT |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P21781 |
| Source | Recombinant |
| Predicted molecular weight | 19 kDa |
Recombinant Human KGF/FGF-7 Protein (rp148028)-Protein Bioactivity
Measured in a cell proliferation assay using 4MBr‑5 rhesus monkey epithelial cell. The ED₅₀ for this effect is typically <1.38ng/mL.
Recombinant Human KGF/FGF-7 Protein(rp148028)-SDS-PAGE
3μg/lane of Recombinant Human KGF was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 19kDa.
| Form | lyophilized |
|---|---|
| Reconstitution | After receiving lyophilized powder protein, centrifuge first, and then redissolve with deionized water to purposed concentration. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Stable for 12 months from the date of receipt of the product under proper storage andhandling conditions. Avoid repeated freeze-thaw cycles. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0400103 | Certificate of Analysis | Apr 06, 2023 | rp148028 |
| ZJ23F0400104 | Certificate of Analysis | Apr 06, 2023 | rp148028 |
| ZJ23F0400105 | Certificate of Analysis | Apr 06, 2023 | rp148028 |
| 1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 2. Aaronson, S A SA and 8 more authors.. (1991) Keratinocyte growth factor. A fibroblast growth factor family member with unusual target cell specificity.. Annals of the New York Academy of Sciences, [PMID:1664700] |
| 3. Finch, P W PW, Rubin, J S JS, Miki, T T, Ron, D D and Aaronson, S A SA.. (1989) Human KGF is FGF-related with properties of a paracrine effector of epithelial cell growth.. Science (New York, N.Y.), (18): [PMID:2475908] |
| 4. Rubin, J S JS and 5 more authors.. (1989) Purification and characterization of a newly identified growth factor specific for epithelial cells.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2915979] |
| 5. Beer, Hans-Dietmar HD and 6 more authors.. (2005) The fibroblast growth factor binding protein is a novel interaction partner of FGF-7, FGF-10 and FGF-22 and regulates FGF activity: implications for epithelial repair.. Oncogene, (11): [PMID:15806171] |
| 6. Zody, Michael C MC and 68 more authors.. (2006) Analysis of the DNA sequence and duplication history of human chromosome 15.. Nature, (30): [PMID:16572171] |
| 7. Zhang, Xiuqin X and 5 more authors.. (2006) Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.. The Journal of biological chemistry, (9): [PMID:16597617] |
