| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155960-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $189.90 | |
| rp155960-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $619.90 | |
| rp155960-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $999.90 | |
| rp155960-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,599.90 |
GMP, ≥95% (SDS-PAGE), Active, Oryza sativa, No tag, 32-194 aa
| Product Name | Recombinant Human KGF Protein, CAS No.148348-15-6 |
|---|---|
| Synonyms | FGF7; FGF-7; fibroblast growth factor 7HBGF-7; HBGF7; HBGF-7; Heparin-binding growth factor 7; keratinocyte growth factor; KGF; KGFfibroblast growth factor 7 (keratinocyte growth factor) |
| Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free, GMP, High performance |
| Product Description |
Keratinocyte growth factor (KGF) is a cytokine found by Rubin et al. (1989) from the culture supernatant of embryonic lung fibroblasts, which is a member of the FGF family, namely FGF-7. KGF is an effective epithelial-specific growth factor secreted by mesenchymal cells and distributed in epithelial cells. Its mitotic activity is mainly manifested in keratinocytes, which can specifically promote the proliferation, migration and differentiation of epithelial cells. It is closely related to organ development, wound repair, tumor genesis and immune reconstruction. |
| Specifications & Purity | ActiBioPure™, Bioactive, GMP, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10 ng/mL. |
| Endotoxin Concentration | ≤0.1EU/μg |
| Expression System | Oryza sativa |
| Species | Human |
| Amino Acids | 32-194 aa |
| Sequence | MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLP MAIT |
| Protein Tag | No tag |
| Source | Rice seed |
| Predicted molecular weight | 19.0 kD |
Recombinant Human KGF Protein (rp155960)-Protein Bioactivity
Measured in a cell proliferation assay using MCF7 breast cancer cell line. The ED₅₀ for this effect is typically <10ng/mL.
Recombinant Human KGF Protein (rp155960)-SDS-PAGE
2μg/lane of Recombinant Human KGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16kDa. Another band is the HSA protein.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended to re dissolve OsrhKGF freeze-dried powder to 100-200 ug/ml with sterile water, and further dilute it with other solvents. The dissolved OsrhKGF can be stored for 2-7 days at 4 ℃ and used up as soon as possible. If it is not used for a s |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Shipped at 4°C. Store at +4°C short term (2-7 days). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Resolution: It is recommended to redissolve lyophilized powder with sterile water to 100-200 ug/ml, and further dilute it with other so |
| CAS | 148348-15-6 |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0300075 | Certificate of Analysis | Mar 25, 2023 | rp155960 |
| ZJ23F0300079 | Certificate of Analysis | Mar 25, 2023 | rp155960 |
| ZJ23F0300074 | Certificate of Analysis | Mar 25, 2023 | rp155960 |
| WGK Germany | 3 |
|---|
