Grouped product items

SKU

Size

Availability

Price

Qty

rp156656-10μg (Trial Size)
Apply for free trial size（?）

10μg

Available within 8-12 weeks(?)

$69.90

rp156656-50μg

50μg

Available within 4-8 weeks(?)

$199.90

rp156656-100μg

100μg

Available within 4-8 weeks(?)

$299.90

rp156656-1mg

1mg

Available within 8-12 weeks(?)

$1,799.90

Basic Description

Product Name	Recombinant Human LC3B Protein, ＞95% (SDS-PAGE), high purity
Synonyms	ATG8F; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; LC3B; LC3II; MAP1 light chain 3 like protein 2; MAP1 light chain 3-like protein 2; MAP1A/1BLC3; MAP1A/MAP1B LC3 B; MAP1A/MAP1B light chain 3 B; MAP1ALC3; Map1lc3b; MA
Grade	Azide Free, Carrier Free
Product Description	Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Function: Probably involved in formation of autophagosomal vacuoles (autophagosomes). Description: MAP1LC3B (Microtubule Associated Protein 1 Light Chain 3 beta, also known as LC3B) is a Protein Coding gene. The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. LC3B is a member of the MAP1 LC3 family. It is most abundantly expressed in the heart, brain, skeletal muscle, and testis. LC3B is a subunit of the neuronal microtubule and functions in the formation of autophagosomal vacuoles (autophagosomes). It is associated with MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. LC3B also plays a role in autophagy, a process that involves the bulk degradation of the cytoplasmic component.
Specifications & Purity	Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	＞95% (SDS-PAGE)
Expression System	E. coli
Species	Human
Amino Acids	1-125 aa
Sequence	MGHHHHHHMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Protein Tag	N-His
Accession #	Q9GZQ8
Predicted molecular weight	15.7 kDa
SDS-PAGE	15.7 kDa

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0700572	Certificate of Analysis	Jul 14, 2023	rp156656
ZJ23F0700573	Certificate of Analysis	Jul 14, 2023	rp156656

FAQs and Articles

FAQ

Aladdin® Target Proteins

Categories: Technical articles

Tags:

Cytokines Drug development Target Proteins Drug Targets Receptors Immune Checkpoints Cell Surface Markers Signaling Pathways

References

1. Kumar S et al.. (2018) Mechanism of Stx17 recruitment to autophagosomes via IRGM and mammalian Atg8 proteins.. J Cell Biol, 217 (3): (997-1013). [PMID:29420192]
2. He, Hua H and 12 more authors.. (2003) Post-translational modifications of three members of the human MAP1LC3 family and detection of a novel type of modification for MAP1LC3B.. The Journal of biological chemistry, (1): [PMID:12740394]
3. Difilippantonio, S S and 8 more authors.. (2003) Gene expression profiles in human non-small and small-cell lung cancers.. European journal of cancer (Oxford, England : 1990), [PMID:12932674]
4. Yang, Y-S YS and 8 more authors.. (2003) The gene expression profiling of sporadic pheochromocytoma and novel full-length cDNAs cloning.. Endocrine-related cancer, [PMID:14713272]
5. Tanida, Isei I and 5 more authors.. (2004) HsAtg4B/HsApg4B/autophagin-1 cleaves the carboxyl termini of three human Atg8 homologues and delipidates microtubule-associated protein light chain 3- and GABAA receptor-associated protein-phospholipid conjugates.. The Journal of biological chemistry, (27): [PMID:15187094]
6. Tanida, Isei I, Ueno, Takashi T and Kominami, Eiki E.. (2004) LC3 conjugation system in mammalian autophagy.. The international journal of biochemistry & cell biology, [PMID:15325588]
7. Tanida, Isei I, Ueno, Takashi T and Kominami, Eiki E.. (2004) Human light chain 3/MAP1LC3B is cleaved at its carboxyl-terminal Met121 to expose Gly120 for lipidation and targeting to autophagosomal membranes.. The Journal of biological chemistry, (12): [PMID:15355958]
8. Kouno, Takahide T and 9 more authors.. (2005) Solution structure of microtubule-associated protein light chain 3 and identification of its functional subdomains.. The Journal of biological chemistry, (1): [PMID:15857831]
9. Pankiv, Serhiy S and 8 more authors.. (2007) p62/SQSTM1 binds directly to Atg8/LC3 to facilitate degradation of ubiquitinated protein aggregates by autophagy.. The Journal of biological chemistry, (17): [PMID:17580304]
10. Pankiv, Serhiy S and 7 more authors.. (2010) FYCO1 is a Rab7 effector that binds to LC3 and PI3P to mediate microtubule plus end-directed vesicle transport.. The Journal of cell biology, (25): [PMID:20100911]
11. Rothenberg, Cara C and 9 more authors.. (2010) Ubiquilin functions in autophagy and is degraded by chaperone-mediated autophagy.. Human molecular genetics, (15): [PMID:20529957]
12. Behrends, Christian C, Sowa, Mathew E ME, Gygi, Steven P SP and Harper, J Wade JW.. (2010) Network organization of the human autophagy system.. Nature, (1): [PMID:20562859]
13. Itoh, Takashi T, Kanno, Eiko E, Uemura, Takefumi T, Waguri, Satoshi S and Fukuda, Mitsunori M.. (2011) OATL1, a novel autophagosome-resident Rab33B-GAP, regulates autophagosomal maturation.. The Journal of cell biology, (7): [PMID:21383079]
14. Popovic, Doris D and 5 more authors.. (2012) Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.. Molecular and cellular biology, [PMID:22354992]
15. Sancho, Ana A and 13 more authors.. (2012) DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding dual regulators of autophagy and transcription.. PloS one, [PMID:22470510]
16. Sentelle, R David and 11 more authors.. (2012) Ceramide targets autophagosomes to mitochondria and induces lethal mitophagy.. Nature chemical biology, [PMID:22922758]
17. Colecchia, David D and 8 more authors.. (2012) MAPK15/ERK8 stimulates autophagy by interacting with LC3 and GABARAP proteins.. Autophagy, [PMID:22948227]
18. Choy, Augustine A and 6 more authors.. (2012) The Legionella effector RavZ inhibits host autophagy through irreversible Atg8 deconjugation.. Science (New York, N.Y.), (23): [PMID:23112293]
19. Zhu, Yanyan Y and 9 more authors.. (2013) Modulation of serines 17 and 24 in the LC3-interacting region of Bnip3 determines pro-survival mitophagy versus apoptosis.. The Journal of biological chemistry, (11): [PMID:23209295]
20. Lee, Dong Yun DY, Arnott, David D and Brown, Eric J EJ.. (2013) Ubiquilin4 is an adaptor protein that recruits Ubiquilin1 to the autophagy machinery.. EMBO reports, [PMID:23459205]
21. Liu, Chao C and 5 more authors.. (2013) Arginine68 is an essential residue for the C-terminal cleavage of human Atg8 family proteins.. BMC cell biology, (30): [PMID:23721406]
22. Tang, Zaiming Z and 7 more authors.. (2013) Autophagy promotes primary ciliogenesis by removing OFD1 from centriolar satellites.. Nature, (10): [PMID:24089205]
23. Suzuki, Hironori H and 7 more authors.. (2014) Structural basis of the autophagy-related LC3/Atg13 LIR complex: recognition and interaction mechanism.. Structure (London, England : 1993), (7): [PMID:24290141]
24. Lystad, Alf Håkon AH and 11 more authors.. (2014) Structural determinants in GABARAP required for the selective binding and recruitment of ALFY to LC3B-positive structures.. EMBO reports, [PMID:24668264]
25. Strappazzon, F F and 10 more authors.. (2015) AMBRA1 is able to induce mitophagy via LC3 binding, regardless of PARKIN and p62/SQSTM1.. Cell death and differentiation, [PMID:25215947]
26. Genau, Heide Marika HM and 7 more authors.. (2015) CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling.. Molecular cell, (19): [PMID:25684205]
27. Khaminets, Aliaksandr A and 17 more authors.. (2015) Regulation of endoplasmic reticulum turnover by selective autophagy.. Nature, (18): [PMID:26040720]
28. Tumbarello, David A DA and 6 more authors.. (2015) The Autophagy Receptor TAX1BP1 and the Molecular Motor Myosin VI Are Required for Clearance of Salmonella Typhimurium by Autophagy.. PLoS pathogens, [PMID:26451915]
29. Wei, Yongjie Y, Chiang, Wei-Chung WC, Sumpter, Rhea R, Mishra, Prashant P and Levine, Beth B.. (2017) Prohibitin 2 Is an Inner Mitochondrial Membrane Mitophagy Receptor.. Cell, (12): [PMID:28017329]
30. Yang, Aimin A, Pantoom, Supansa S and Wu, Yao-Wen YW.. (2017) Elucidation of the anti-autophagy mechanism of the Legionella effector RavZ using semisynthetic LC3 proteins.. eLife, (11): [PMID:28395732]
31. Kwon, Do Hoon DH and 6 more authors.. (2017) A novel conformation of the LC3-interacting region motif revealed by the structure of a complex between LC3B and RavZ.. Biochemical and biophysical research communications, (26): [PMID:28668392]
32. Jena, Kautilya Kumar and 11 more authors.. (2018) TRIM16 controls assembly and degradation of protein aggregates by modulating the p62-NRF2 axis and autophagy.. The EMBO journal, (14): [PMID:30143514]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Recombinant Human LC3B Protein, ＞95% (SDS-PAGE), high purity