| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148245-100μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $87.90 | |
| rp148245-1mg | 1mg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $357.90 | |
| rp148245-200μg | 200μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $117.90 | |
| rp148245-5mg | 5mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,707.90 |
Animal Free, >97%(SDS-PAGE and HPLC), Active, E.coli, No tag, 22-167 aa
| Product Name | Recombinant Human Leptin Protein, ＞97%(SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | FLJ94114; LEP; Leptin (murine obesity homolog); Leptin (obesity homolog, mouse); Leptin; OB; Obese protein; obese, mouse, homolog of; Obesity factor; OBOBS;FLJ94114;LEP_HUMAN;LEPD;Leptin;Leptin Murine Obesity Homolog;Leptin Precursor Obesity Factor;Obesit |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97%(SDS-PAGE and HPLC) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
| Species | Human |
| Amino Acids | 22-167 aa |
| Sequence | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Protein Tag | No tag |
| Protein Length | Protein Fragment |
| Accession # | P41159 |
| Source | Recombinant |
| Predicted molecular weight | 16 kDa |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
Recombinant Human Leptin Protein (rp148245)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/mL, corresponding to a specific activity of > 5.0×10⁵ IU/mg
Recombinant Human Leptin Protein (rp148245)-SDS-PAGE
Recombinant Human Leptin Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 16.0 kDa.
| Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
|---|
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Dry ice |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600320 | Certificate of Analysis | Mar 26, 2024 | rp148245 |
| ZJ23F0600321 | Certificate of Analysis | Mar 26, 2024 | rp148245 |
| ZJ23F0600325 | Certificate of Analysis | Mar 26, 2024 | rp148245 |
