| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148245-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $69.90 | |
| rp148245-1mg | 1mg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $389.90 | |
| rp148245-200μg | 200μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $109.90 | |
| rp148245-5mg | 5mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,699.90 |
Animal Free, >97%(SDS-PAGE and HPLC), Active, E.coli, No tag, 22-167 aa
| Product Name | Recombinant Human Leptin Protein, ＞97%(SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | FLJ94114; LEP; Leptin (murine obesity homolog); Leptin (obesity homolog, mouse); Leptin; OB; Obese protein; obese, mouse, homolog of; Obesity factor; OBOBS;FLJ94114;LEP_HUMAN;LEPD;Leptin;Leptin Murine Obesity Homolog;Leptin Precursor Obesity Factor;Obesit |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >97% SDS-PAGE. Recombinant human Leptin was overexpressed as insoluble protein aggregate in E.coli and purified by FPLC gel-filtration chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer. Function May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97%(SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 22-167 aa |
| Sequence | VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC |
| Protein Tag | No tag |
| Protein Length | Protein Fragment |
| Accession # | P41159 |
| Source | Recombinant |
| Predicted molecular weight | 16 kDa |
Recombinant Human Leptin Protein (rp148245)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a chemotaxis bioassay using human Leptin R transfected BaF3 murine proB cells is less than 2 ng/mL, corresponding to a specific activity of > 5.0×10⁵ IU/mg
Recombinant Human Leptin Protein (rp148245)-SDS-PAGE
Recombinant Human Leptin Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 16.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600320 | Certificate of Analysis | Mar 26, 2024 | rp148245 |
| ZJ23F0600321 | Certificate of Analysis | Mar 26, 2024 | rp148245 |
| ZJ23F0600325 | Certificate of Analysis | Mar 26, 2024 | rp148245 |
