| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148270-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $149.90 | |
| rp148270-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $439.90 | |
| rp148270-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $719.90 | |
| rp148270-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,879.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 23-202 aa
| Product Name | Recombinant Human LIF Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CDF; D Factor; DIA; differentiation inhibitory activity; differentiation stimulating factor; Differentiation-stimulating factor; Emfilermin; HILDA; HILDAcholinergic differentiation factor; leukemia inhibitory factor (cholinergic differentiation factor); l |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 0.1-0.3 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 23-202 aa |
| Sequence | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFHHHHHH |
| Protein Tag | C-His |
| Accession # | P15018 |
| Predicted molecular weight | 20 kDa |
| SDS-PAGE | 33-45 kDa, under reducing conditions |
Recombinant Human LIF Protein (rp148270) - SDS-PAGE
3 μg/lane of Recombinant Human LIF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 35 - 45 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0506247 | Certificate of Analysis | May 31, 2024 | rp148270 |
| ZJ24F0506246 | Certificate of Analysis | May 31, 2024 | rp148270 |
| ZJ24F0506245 | Certificate of Analysis | May 31, 2024 | rp148270 |
| 1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 2. Stahl, J J and 5 more authors.. (1990) Structural organization of the genes for murine and human leukemia inhibitory factor. Evolutionary conservation of coding and non-coding regions.. The Journal of biological chemistry, (25): [PMID:1692837] |
| 3. Lowe, D G DG and 9 more authors.. (1989) Genomic cloning and heterologous expression of human differentiation-stimulating factor.. DNA (Mary Ann Liebert, Inc.), [PMID:2475312] |
| 4. Mori, M M, Yamaguchi, K K and Abe, K K.. (1989) Purification of a lipoprotein lipase-inhibiting protein produced by a melanoma cell line associated with cancer cachexia.. Biochemical and biophysical research communications, (15): [PMID:2730639] |
| 5. Gough, N M NM and 6 more authors.. (1988) Molecular cloning and expression of the human homologue of the murine gene encoding myeloid leukemia-inhibitory factor.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:3128791] |
| 6. Moreau, J F JF and 5 more authors.. (1988) Leukaemia inhibitory factor is identical to the myeloid growth factor human interleukin for DA cells.. Nature, (15): [PMID:3143918] |
| 7. Schmelzer, C H CH and 5 more authors.. (1993) Glycosylation pattern and disulfide assignments of recombinant human differentiation-stimulating factor.. Archives of biochemistry and biophysics, [PMID:8489250] |
| 8. Dunham, I I and 24 more authors.. (1999) The DNA sequence of human chromosome 22.. Nature, (2): [PMID:10591208] |
| 9. Boulanger, Martin J MJ, Bankovich, Alexander J AJ, Kortemme, Tanja T, Baker, David D and Garcia, K Christopher KC.. (2003) Convergent mechanisms for recognition of divergent cytokines by the shared signaling receptor gp130.. Molecular cell, [PMID:14527405] |
| 10. Brandenberger, Ralph R and 13 more authors.. (2004) Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.. Nature biotechnology, [PMID:15146197] |
| 11. Huyton, Trevor T and 6 more authors.. (2007) An unusual cytokine:Ig-domain interaction revealed in the crystal structure of leukemia inhibitory factor (LIF) in complex with the LIF receptor.. Proceedings of the National Academy of Sciences of the United States of America, (31): [PMID:17652170] |
