| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148284-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp148284-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $419.90 | |
| rp148284-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $659.90 | |
| rp148284-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 24-458 aa
| Product Name | Recombinant Human LILRB1/CD85j/ILT2 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Leukocyte Immunoglobulin-like Receptor, Subfamily A (with TM domain), Member 1 | CD85 antigen-like family member J | CD85j antigen | CD85j | Ig-like transcript 2 | ILT2 | ILT-2 | FLJ37515 | Immunoglobulin-like transcript 2 | leukocyte Ig-like receptor-1 | |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | When Recombinant Human LILRB1/CD85j/ILT2 is coated at 2 µg/mL, Recombinant Human Angiopoietin-like Protein 7/ANGPTL7 binds with a typical ED50 of 0.02-0.2 μg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 24-458 aa |
| Sequence | GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLS |
| Protein Tag | C-His |
| Accession # | Q8NHL6 |
| Predicted molecular weight | 48 kDa |
| SDS-PAGE | 60.0 - 80.0 kDa, under reducing conditions; 60.0 - 80.0 kDa, under non-reducing conditions. |
Recombinant Human LILRB1/CD85j/ILT2 Protein (rp148284) - Protein Bioactivity
When Recombinant Human LILRB1/CD85j/ILT2 Protein (rp148284) is coated at 4.0 µg/mL, Biotinylated Recombinant Human Angiopoietin-like 7/ANGPTL7 Protein (rp142833) binds with the ED
₅₀
of 2.0 μg/mL.
Recombinant Human LILRB1/CD85j/ILT2 Protein (rp148284) - SDS-PAGE
3 μg/lane of Recombinant Human LILRB1/CD85j/ILT2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 60.0 - 80.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0607354 | Certificate of Analysis | Jun 28, 2024 | rp148284 |
| ZJ24F0607353 | Certificate of Analysis | Jun 28, 2024 | rp148284 |
| ZJ24F0607352 | Certificate of Analysis | Jun 28, 2024 | rp148284 |
