| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148631-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $99.90 | |
| rp148631-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $389.90 | |
| rp148631-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $629.90 | |
| rp148631-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, >97%(SDS-PAGE, HPLC), Active, E.coli, No tag, 25-93aa
| Product Name | Recombinant Human MDC Protein, ＞97%(SDS-PAGE, HPLC), high purity |
|---|---|
| Synonyms | A-152E5.1; ABCD-1; CC chemokine STCP-1; C-C motif chemokine 22; CCL22; chemokine (C-C motif) ligand 22; DC/B-CK; Macrophage-derived chemokine; MDC; MDCStimulated T-cell chemotactic protein 1; MGC34554; SCYA22MDC(1-69); small inducible cytokine A22; small |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97%(SDS-PAGE, HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100ng/ml. |
| Endotoxin Concentration | ＜1 EU/µg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 25-93aa |
| Sequence | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ |
| Protein Tag | No tag |
| Accession # | O00626 |
| Predicted molecular weight | 8.1 kDa |
| SDS-PAGE | 8.1 kDa |
Recombinant Human MDC Protein (rp148631)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/mL.
Recombinant Human MDC Protein (rp148631)-SDS-PAGE
Recombinant Human MDC Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 8.1 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600419 | Certificate of Analysis | Mar 26, 2024 | rp148631 |
| ZJ23F0600420 | Certificate of Analysis | Mar 26, 2024 | rp148631 |
| ZJ23F0600421 | Certificate of Analysis | Mar 26, 2024 | rp148631 |
| 1. Imai T, Chantry D, Raport CJ, Wood CL, Nishimura M, Godiska R, Yoshie O, Gray PW. (1998) Macrophage-derived chemokine is a functional ligand for the CC chemokine receptor 4.. J Biol Chem, 273 (3): (1764-8). [PMID:9430724] |
| 2. Vulcano M, Albanesi C, Stoppacciaro A, Bagnati R, D'Amico G, Struyf S, Transidico P, Bonecchi R, Del Prete A, Allavena P et al.. (2001) Dendritic cells as a major source of macrophage-derived chemokine/CCL22 in vitro and in vivo.. Eur J Immunol, 31 (3): (812-22). [PMID:11241286] |
| 3. Godiska R, Chantry D, Raport CJ, Sozzani S, Allavena P, Leviten D, Mantovani A, Gray PW. (1997) Human macrophage-derived chemokine (MDC), a novel chemoattractant for monocytes, monocyte-derived dendritic cells, and natural killer cells.. J Exp Med, 185 (9): (1595-604). [PMID:9151897] |
| 4. Regenass P, Abboud D, Daubeuf F, Lehalle C, Gizzi P, Riché S, Hachet-Haas M, Rohmer F, Gasparik V, Boeglin D et al.. (2018) Discovery of a Locally and Orally Active CXCL12 Neutraligand (LIT-927) with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia.. J Med Chem, 61 (17): (7671-7686). [PMID:30106292] |
| 5. Chang, M s Ms and 7 more authors.. (1997) Molecular cloning and functional characterization of a novel CC chemokine, stimulated T cell chemotactic protein (STCP-1) that specifically acts on activated T lymphocytes.. The Journal of biological chemistry, (3): [PMID:9312138] |
| 6. Loftus, B J BJ and 18 more authors.. (1999) Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.. Genomics, (15): [PMID:10493829] |
| 7. Martin, Joel J and 121 more authors.. (2004) The sequence and analysis of duplication-rich human chromosome 16.. Nature, (23): [PMID:15616553] |
