| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148684-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $69.90 | |
| rp148684-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $329.90 | |
| rp148684-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $599.90 | |
| rp148684-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,999.90 |
Animal Free, >97%( SDS-PAGE and HPLC), Active, E.coli, No tag, 25-131aa
| Product Name | Recombinant Human Melanoma Inhibitory Activity Protein, ＞97%( SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | CD-RAP; Melanoma inhibitory activity protein; melanoma inhibitory activity; melanoma-derived growth regulatory protein; MIA |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97%( SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human A375 cell line is less than 5 μg/ml, corresponding to a specific activity of > 200 IU/mg. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 25-131aa |
| Sequence | GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFW GGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
| Protein Tag | No tag |
| Protein Length | Protein fragment |
| Accession # | Q16674 |
| Source | Recombinant |
| Predicted molecular weight | 12.1 kDa |
| SDS-PAGE | 12.1 kDa |
Recombinant Human Melanoma Inhibitory Activity Protein (rp148684)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using human A375 cell line is less than 5 μg/mL, corresponding to a specific activity of > 200 IU/mg.
Recombinant Human Melanoma Inhibitory Activity Protein (rp148684)-SDS-PAGE
Recombinant Human Melanoma Inhibitory Activity Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 12.1 kDa under reducing conditions and 10.3 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4oC for 1 week or -20oC for future use. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze/thaw cycles. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600335 | Certificate of Analysis | Mar 26, 2024 | rp148684 |
| ZJ23F0600336 | Certificate of Analysis | Mar 26, 2024 | rp148684 |
| ZJ23F0600337 | Certificate of Analysis | Mar 26, 2024 | rp148684 |
| 1. Blesch, A A and 9 more authors.. (1994) Cloning of a novel malignant melanoma-derived growth-regulatory protein, MIA.. Cancer research, (1): [PMID:7923218] |
| 2. Bosserhoff, A K AK, Hein, R R, Bogdahn, U U and Buettner, R R.. (1996) Structure and promoter analysis of the gene encoding the human melanoma-inhibiting protein MIA.. The Journal of biological chemistry, (5): [PMID:8550608] |
| 3. Lougheed, J C JC, Holton, J M JM, Alber, T T, Bazan, J F JF and Handel, T M TM.. (2001) Structure of melanoma inhibitory activity protein, a member of a recently identified family of secreted proteins.. Proceedings of the National Academy of Sciences of the United States of America, (8): [PMID:11331761] |
| 4. Hau, Peter P and 7 more authors.. (2002) Cloning and characterization of the expression pattern of a novel splice product MIA (splice) of malignant melanoma-derived growth-inhibiting activity (MIA/CD-RAP) [corrected].. The Journal of investigative dermatology, [PMID:12230496] |
| 5. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 6. Voss, Matthias M, Lettau, Marcus M and Janssen, Ottmar O.. (2009) Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.. BMC immunology, (6): [PMID:19807924] |
| 7. Rahimi, Nader N, Rezazadeh, Kobra K, Mahoney, John E JE, Hartsough, Edward E and Meyer, Rosana D RD.. (2012) Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.. Molecular biology of the cell, [PMID:22419821] |
