| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp148798-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp148798-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $359.90 | |
| rp148798-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp148798-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,899.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 1-308 aa
| Product Name | Recombinant Human MICA Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | MIC-A | HLA class I antigen | FLJ36918 | FLJ60820 | MGC111087 | MGC21250 | MHC class I chain related gene A protein | MHC class I chain related protein A | MHC class I chain related protein A HLA B HLA C | MHC class I polypeptide related sequence A | MHC |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human MICA Protein (rp148798) at 2.0 μg/mL can bind Human NKG2D with the ED50 for this effect is 12.22 ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 1-308 aa |
| Sequence | MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGD |
| Protein Tag | C-His |
| Accession # | Q29983 |
| Predicted molecular weight | 36 kDa |
| SDS-PAGE | 50 - 65 kDa, under reducing conditions; 50 - 65 kDa, under non-reducing conditions. |
Recombinant Human MICA Protein (rp148798) - Protein Bioactivity
Immobilized Recombinant Human MICA Protein (rp148798) at 2.0 μg/mL can bind Human NKG2D with the ED₅₀ for this effect is 12.22 ng/mL.
Recombinant Human MICA Protein (rp148798) - SDS-PAGE
3 μg/lane of Recombinant Human MICA Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 50 - 65 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
| 1. Bauer S, Groh V, Wu J, Steinle A, Phillips JH, Lanier LL, Spies T. () Activation of NK cells and T cells by NKG2D, a receptor for stress-inducible MICA.. Science, [PMID:10426993] |
| 2. Groh V, Rhinehart R, Randolph-Habecker J, Topp MS, Riddell SR, Spies T. () Costimulation of CD8alphabeta T cells by NKG2D via engagement by MIC induced on virus-infected cells.. Nat Immunol, [PMID:11224526] |
| 3. Leelayuwat, C C, Townend, D C DC, Degli-Esposti, M A MA, Abraham, L J LJ and Dawkins, R L RL.. (1994) A new polymorphic and multicopy MHC gene family related to nonmammalian class I.. Immunogenetics, [PMID:7927538] |
| 4. Bahram, S S, Bresnahan, M M, Geraghty, D E DE and Spies, T T.. (1994) A second lineage of mammalian major histocompatibility complex class I genes.. Proceedings of the National Academy of Sciences of the United States of America, (5): [PMID:8022771] |
| 5. Bahram, S S, Mizuki, N N, Inoko, H H and Spies, T T.. (1996) Nucleotide sequence of the human MHC class I MICA gene.. Immunogenetics, [PMID:8613147] |
| 6. Fodil, N N and 9 more authors.. (1996) Allelic repertoire of the human MHC class I MICA gene.. Immunogenetics, [PMID:8781120] |
| 7. Groh, V V and 5 more authors.. (1996) Cell stress-regulated human major histocompatibility complex class I gene expressed in gastrointestinal epithelium.. Proceedings of the National Academy of Sciences of the United States of America, (29): [PMID:8901601] |
| 8. Zwirner, N W NW, Fernández-Viña, M A MA and Stastny, P P.. (1998) MICA, a new polymorphic HLA-related antigen, is expressed mainly by keratinocytes, endothelial cells, and monocytes.. Immunogenetics, [PMID:9396860] |
| 9. Groh, V V, Steinle, A A, Bauer, S S and Spies, T T.. (1998) Recognition of stress-induced MHC molecules by intestinal epithelial gammadelta T cells.. Science (New York, N.Y.), (13): [PMID:9497295] |
| 10. Gonzalez, S S and 7 more authors.. (1999) The MICA-A9 triplet repeat polymorphism in the transmembrane region confers additional susceptibility to the development of psoriatic arthritis and is independent of the association of Cw*0602 in psoriasis.. Arthritis and rheumatism, [PMID:10323458] |
| 11. Yao, Z Z and 6 more authors.. () Definition of new alleles of MIC-A using sequencing-based typing.. European journal of immunogenetics : official journal of the British Society for Histocompatibility and Immunogenetics, [PMID:10331160] |
| 12. Groh, V V and 5 more authors.. (1999) Broad tumor-associated expression and recognition by tumor-derived gamma delta T cells of MICA and MICB.. Proceedings of the National Academy of Sciences of the United States of America, (8): [PMID:10359807] |
| 13. Zwirner, N W NW, Dole, K K and Stastny, P P.. (1999) Differential surface expression of MICA by endothelial cells, fibroblasts, keratinocytes, and monocytes.. Human immunology, [PMID:10363723] |
| 14. Li, P P and 5 more authors.. (1999) Crystal structure of the MHC class I homolog MIC-A, a gammadelta T cell ligand.. Immunity, [PMID:10367903] |
| 15. Petersdorf, E W EW, Shuler, K B KB, Longton, G M GM, Spies, T T and Hansen, J A JA.. (1999) Population study of allelic diversity in the human MHC class I-related MIC-A gene.. Immunogenetics, [PMID:10369917] |
| 16. Komatsu-Wakui, M M and 10 more authors.. (1999) MIC-A polymorphism in Japanese and a MIC-A-MIC-B null haplotype.. Immunogenetics, [PMID:10369920] |
| 17. Fodil, N N and 5 more authors.. (1999) MICA haplotypic diversity.. Immunogenetics, [PMID:10380703] |
| 18. Visser, C J CJ and 8 more authors.. (1999) Sequencing-based typing of MICA reveals 33 alleles: a study on linkage with classical HLA genes.. Immunogenetics, [PMID:10380704] |
| 19. Wu, J J and 6 more authors.. (1999) An activating immunoreceptor complex formed by NKG2D and DAP10.. Science (New York, N.Y.), (30): [PMID:10426994] |
| 20. Tay, G K GK and 8 more authors.. (2000) PERB11 (MIC): a polymorphic MHC gene is expressed in skin and single nucleotide polymorphisms are associated with psoriasis.. Clinical and experimental immunology, [PMID:10691930] |
| 21. Pérez-Rodríguez, M M and 6 more authors.. (2000) A new MICA allele with ten alanine residues in the exon 5 microsatellite.. Tissue antigens, [PMID:10746789] |
| 22. Li, Z Z, Groh, V V, Strong, R K RK and Spies, T T.. (2000) A single amino acid substitution causes loss of expression of a MICA allele.. Immunogenetics, [PMID:10752636] |
| 23. Zwirner, N W NW, Marcos, C Y CY, Mirbaha, F F, Zou, Y Y and Stastny, P P.. (2000) Identification of MICA as a new polymorphic alloantigen recognized by antibodies in sera of organ transplant recipients.. Human immunology, [PMID:11053635] |
| 24. Li, P P and 5 more authors.. (2001) Complex structure of the activating immunoreceptor NKG2D and its MHC class I-like ligand MICA.. Nature immunology, [PMID:11323699] |
| 25. Das, H H and 6 more authors.. (2001) MICA engagement by human Vgamma2Vdelta2 T cells enhances their antigen-dependent effector function.. Immunity, [PMID:11485740] |
| 26. Steinle, A A and 6 more authors.. () Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family.. Immunogenetics, [PMID:11491531] |
| 27. Obuchi, N N and 11 more authors.. (2001) Identification of MICA alleles with a long Leu-repeat in the transmembrane region and no cytoplasmic tail due to a frameshift-deletion in exon 4.. Tissue antigens, [PMID:11556982] |
| 28. Sutherland, Claire L CL and 5 more authors.. (2002) UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:11777960] |
| 29. Tieng, Vannary V and 7 more authors.. (2002) Binding of Escherichia coli adhesin AfaE to CD55 triggers cell-surface expression of the MHC class I-related molecule MICA.. Proceedings of the National Academy of Sciences of the United States of America, (5): [PMID:11830641] |
| 30. Pérez-Rodríguez, M M and 10 more authors.. (2002) Further polymorphism of the MICA gene.. European journal of immunogenetics : official journal of the British Society for Histocompatibility and Immunogenetics, [PMID:11841487] |
| 31. Pérez-Rodríguez, M M, Raimondi, E E, Marsh, Steven G E SG and Madrigal, J A JA.. (2002) Identification of a new MICA allele, MICA*047.. Tissue antigens, [PMID:12074712] |
| 32. Salih, Helmut R HR, Rammensee, Hans-Georg HG and Steinle, Alexander A.. (2002) Cutting edge: down-regulation of MICA on human tumors by proteolytic shedding.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:12370336] |
| 33. Groh, Veronika V, Wu, Jennifer J, Yee, Cassian C and Spies, Thomas T.. (2002) Tumour-derived soluble MIC ligands impair expression of NKG2D and T-cell activation.. Nature, (17): [PMID:12384702] |
| 34. Zou, Yizhou Y and Stastny, Peter P.. (2002) Alternatively spliced forms of MICA and MICB lacking exon 3 in a human cell line and evidence of presence of similar RNA in human peripheral blood mononuclear cells.. Immunogenetics, [PMID:12466900] |
| 35. Rueda, B B, Pascual, M M, López-Nevot, M A MA, González, E E and Martín, J J.. (2002) A new allele within the transmembrane region of the human MICA gene with seven GCT repeats.. Tissue antigens, [PMID:12542746] |
| 36. Hüe, Sophie S, Monteiro, Renato C RC, Berrih-Aknin, Sonia S and Caillat-Zucman, Sophie S.. (2003) Potential role of NKG2D/MHC class I-related chain A interaction in intrathymic maturation of single-positive CD8 T cells.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:12902493] |
| 37. Quiroga, I I and 6 more authors.. (2004) Identification of a novel MICA allele: MICA*051.. Tissue antigens, [PMID:15104678] |
| 38. Gasser, Stephan S, Orsulic, Sandra S, Brown, Eric J EJ and Raulet, David H DH.. (2005) The DNA damage pathway regulates innate immune system ligands of the NKG2D receptor.. Nature, (25): [PMID:15995699] |
| 39. Quiroga, I I and 6 more authors.. (2006) The identification of three novel MICA alleles by sequence-based typing.. Tissue antigens, [PMID:16634869] |
| 40. Chalupny, N Jan NJ, Rein-Weston, Annie A, Dosch, Stephanie S and Cosman, David D.. (2006) Down-regulation of the NKG2D ligand MICA by the human cytomegalovirus glycoprotein UL142.. Biochemical and biophysical research communications, (21): [PMID:16750166] |
| 41. Kaiser, Brett K BK and 8 more authors.. (2007) Disulphide-isomerase-enabled shedding of tumour-associated NKG2D ligands.. Nature, (24): [PMID:17495932] |
| 42. Schrambach, Stéphanie S, Ardizzone, Marc M, Leymarie, Vincent V, Sibilia, Jean J and Bahram, Seiamak S.. (2007) In vivo expression pattern of MICA and MICB and its relevance to auto-immunity and cancer.. PloS one, (13): [PMID:17565371] |
| 43. Jinushi, Masahisa M and 9 more authors.. (2008) MHC class I chain-related protein A antibodies and shedding are associated with the progression of multiple myeloma.. Proceedings of the National Academy of Sciences of the United States of America, (29): [PMID:18202175] |
| 44. McSharry, Brian P BP and 13 more authors.. (2008) Adenovirus E3/19K promotes evasion of NK cell recognition by intracellular sequestration of the NKG2D ligands major histocompatibility complex class I chain-related proteins A and B.. Journal of virology, [PMID:18287244] |
| 45. Ashiru, Omodele O and 5 more authors.. (2009) NKG2D ligand MICA is retained in the cis-Golgi apparatus by human cytomegalovirus protein UL142.. Journal of virology, [PMID:19793804] |
