Recombinant Human MMP-2 Protein

Item Number

rp181213

• Product Name: Recombinant Human MMP-2 Protein
• Grade: Animal Free, Bioactive, Carrier Free
• Specifications & Purity: Animal Free, Carrier Free, Bioactive, ≥90%(SDS-PAGE)
• Bioactivity: Immobilized Recombinant Human MMP-2 Protein (rp181213) at 1.0 μg/mL can bind MMP2 Mouse mAb (Ab115657) with the EC50 of 23.04 ng/mL
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-660 aa
• Sequence: MEALMARGALTGPLRALCLLGCLLSHAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDG
• Protein Tag: C-His
• Predicted molecular weight: 71.8 kDa
• SDS-PAGE: 70.7 kDa, under reducing conditions

Product Description

Purity: ≥90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Matrix Metalloproteinase-2 (MMP-2) is an enzyme that degrades components of the extracellular matrix and thus plays a pivotal role in cell migration during physiological and pathological processes. MMP-2 expression is dependent on extracellular matrix metalloproteinase inducer (EMMPRIN), Her2/neu, growth factors, cytokines, and hormones. Pro-MMP-2 activation needs MT1-MMP and TIMP-2 contribution. MMP-2 is changed in distribution and increased in amount in the ventral cochlear nucleus after unilateral cochlear ablation. A low level of MMP-2 is linked to a favorable prognosis in patients with a hormone receptor-negative tumor, usually associated with high risk. As a zymogen requiring proteolytic activation for catalytic activity, MMP-2 has been implicated broadly in the invasion and metastasis of many cancer model systems, including human breast cancer (HBC). Blocking MMP-2 secretion and activation during breast carcinoma development may decrease metastasis. The detection of active MMP-2 alone or the rate of pro-MMP-2 and active MMP-2 is considered a very sensitive indicator of cancer metastasis. Modulation of MMP-2 expression and activation through specific inhibitors and activators may thus provide a new mechanism for breast cancer treatment.