| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp156330-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp156330-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp156330-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $219.90 | |
| rp156330-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,279.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 121-191 aa
| Product Name | Recombinant Human NRG1-beta 1 Protein |
|---|---|
| Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
| Product Description | Protein Function: |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, High performance, ≥95%(SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using MCF‑7 human breast cancer cells. The ED50 for this effect is typically 0.73 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 121-191 aa |
| Sequence | TSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQK |
| Protein Tag | No tag |
| Predicted molecular weight | 8.2 kDa |
| SDS-PAGE | 11.1 kDa, under reducing conditions; 11.2 kDa, under non-reducing conditions |
Recombinant Human NRG1-beta 1 Protein (rp156330) - Protein Bioactivity
Measured in a cell proliferation assay using MCF‑7 human breast cancer cells. The ED₅₀ for this effect is typically 0.73 ng/mL.
Recombinant Human NRG1-beta 1 Protein (rp156330) - SDS-PAGE
3 μg/lane of Recombinant Human NRG1-beta 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 11.1 kDa under reducing conditions and 11.2 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
