| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp146610-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp146610-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $279.90 | |
| rp146610-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $449.90 | |
| rp146610-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 23-486 aa
| Product Name | Recombinant Human Osteoactivin/GPNMB Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Hematopoietic growth factor inducible neurokinin-1 type | PLCA3 | NMBosteoactivin | Osteoactivin | Transmembrane glycoprotein HGFIN | transmembrane glycoprotein NMB | NMB | Glycoprotein Non-Metastatic Melanoma Protein B | DC-HIL | glycoprotein (transmembr |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human Osteoactivin/GPNMB Protein (rp146610) at 1.0 μg/mL can bind GPNMB Antibody with the EC50 is 129.8 ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 23-486 aa |
| Sequence | KRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYS |
| Protein Tag | C-His |
| Accession # | Q14956 |
| Predicted molecular weight | 53 kDa |
| SDS-PAGE | 70 - 100 kDa, under reducing conditions; 70 - 100 kDa, under non-reducing conditions. |
Recombinant Human Osteoactivin/GPNMB Protein (rp146610) - Protein Bioactivity
Immobilized Recombinant Human Osteoactivin/GPNMB Protein (rp146610) at 1.0 μg/mL can bind GPNMB Antibody with the EC50 is 129.8 ng/mL.
Recombinant Human Osteoactivin/GPNMB Protein (rp146610) - SDS-PAGE
3 μg/lane of Recombinant Human Osteoactivin/GPNMB Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 70 - 100 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
| 1. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R et al.. (2003) Human chromosome 7: DNA sequence and biology.. Science, 300 (5620): (767-72). [PMID:12690205] |
| 2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] |
| 3. Rose AA, Grosset AA, Dong Z, Russo C, Macdonald PA, Bertos NR, St-Pierre Y, Simantov R, Hallett M, Park M et al.. (2010) Glycoprotein nonmetastatic B is an independent prognostic indicator of recurrence and a novel therapeutic target in breast cancer.. Clin Cancer Res, 16 (7): (2147-56). [PMID:20215530] |
| 4. Tse KF, Jeffers M, Pollack VA, McCabe DA, Shadish ML, Khramtsov NV, Hackett CS, Shenoy SG, Kuang B, Boldog FL et al.. (2006) CR011, a fully human monoclonal antibody-auristatin E conjugate, for the treatment of melanoma.. Clin Cancer Res, 12 (4): (1373-82). [PMID:16489096] |
| 5. Kuan CT, Wakiya K, Dowell JM, Herndon 2nd JE, Reardon DA, Graner MW, Riggins GJ, Wikstrand CJ, Bigner DD. (2006) Glycoprotein nonmetastatic melanoma protein B, a potential molecular therapeutic target in patients with glioblastoma multiforme.. Clin Cancer Res, 12 (7 Pt 1): (1970-82). [PMID:16609006] |
| 6. Weterman, M A MA and 6 more authors.. (1995) nmb, a novel gene, is expressed in low-metastatic human melanoma cell lines and xenografts.. International journal of cancer, (3): [PMID:7814155] |
| 7. Bandari, Persis S PS and 9 more authors.. (2003) Hematopoietic growth factor inducible neurokinin-1 type: a transmembrane protein that is similar to neurokinin 1 interacts with substance P.. Regulatory peptides, (28): [PMID:12609765] |
| 8. Basrur, Venkatesha V and 12 more authors.. () Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.. Journal of proteome research, [PMID:12643545] |
| 9. Chi, An A and 16 more authors.. (2006) Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.. Journal of proteome research, [PMID:17081065] |
| 10. Yang, Chi-Fan CF and 7 more authors.. (2018) Loss of GPNMB Causes Autosomal-Recessive Amyloidosis Cutis Dyschromica in Humans.. American journal of human genetics, (1): [PMID:29336782] |
