| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp176706-10μg | 10μg | In stock | $59.90 | |
| rp176706-100μg | 100μg | In stock | $359.90 | |
| rp176706-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,399.90 |
Carrier Free, >95% SDS-PAGE, E.coli, His, 1-198 aa
| Product Name | Recombinant Human p27 KIP 1 Protein, >95% SDS-PAGE, high purity |
|---|---|
| Synonyms | Cyclin-dependent kinase inhibitor 1B | Cyclin-dependent kinase inhibitor p27 | p27Kip1 | AA408329 | AI843786 | Cdki1b | CDKN 1B | CDKN 4 | CDKN1B | CDKN4 | CDN1B_HUMAN | Cyclin Dependent Kinase Inhibitor 1B | Cyclin dependent kinase inhibitor p27 | Cyclin |
| Grade | Azide Free, Carrier Free |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | >95% SDS-PAGE |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 1-198 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT |
| Protein Tag | N-His |
| Predicted molecular weight | 24.2 kDa |
| SDS-PAGE | 29.7 kDa, reducing conditions; 26.7 and 29.4 kDa，non-reducing condition |
Recombinant Human p27 KIP 1 Protein (rp176706) - SDS-PAGE
3 μg/lane of Recombinant Human p27 KIP 1 Protein was resolved with SDS-PAGE under reducing (R) visualized by Coomassie® Blue staining, showing a band at 29.7 kDa under reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0102361 | Certificate of Analysis | Jan 30, 2024 | rp176706 |
| ZJ24F0102360 | Certificate of Analysis | Jan 30, 2024 | rp176706 |
| ZJ24F0102359 | Certificate of Analysis | Jan 30, 2024 | rp176706 |
