| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp149785-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $79.90 | |
| rp149785-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $209.90 | |
| rp149785-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $319.90 | |
| rp149785-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
Animal Free, >97% (SDS-PAGE&HPLC), Active, E. coli, No tag, 32-115 aa
| Product Name | Recombinant Human Parathyroid Hormone Protein, >97% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | hPTH | Parathormone | Parathyrin | Parathyroid hormone | Parathyroid hormone 1 | Prepro PTH | Preproparathyroid hormone | PTH | PTH1 | PTH1 receptor | PTH1R | PTHR | PTHR1 | PTHY_HUMAN | Parathormone | Parathyrin | PTH |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Biochemical and Physiological Mechanisms | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells. |
| Purity | >97% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 32-115 aa |
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Protein Tag | No tag |
| Accession # | P01270 |
| Predicted molecular weight | 9.4 kDa |
| SDS-PAGE | 9.4 kDa |
Recombinant Human Parathyroid Hormone Protein (rp149785) - Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/mL, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg.
Recombinant Human Parathyroid Hormone Protein (rp149785) - SDS-PAGE
Recombinant Human Parathyroid Hormone Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.4 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1001337 | Certificate of Analysis | Oct 19, 2023 | rp149785 |
| ZJ23F1001338 | Certificate of Analysis | Oct 19, 2023 | rp149785 |
| ZJ23F1001339 | Certificate of Analysis | Oct 19, 2023 | rp149785 |
| 1. Pioszak AA, Xu HE. (2008) Molecular recognition of parathyroid hormone by its G protein-coupled receptor.. Proc Natl Acad Sci USA, 105 (13): (5034-9). [PMID:18375760] [10.1021/op500134e] |
| 2. Keutmann, H T HT, Sauer, M M MM, Hendy, G N GN, O'Riordan, L H LH and Potts, J T JT.. (1978) Complete amino acid sequence of human parathyroid hormone.. Biochemistry, (26): [PMID:728431] |
| 3. Keutmann, H T HT, Niall, H D HD, O'Riordan, J L JL and Potts, J T JT.. (1975) A reinvestigation of the amino-terminal sequence of human parathyroid hormone.. Biochemistry, (6): [PMID:1125201] |
| 4. Klaus, W W and 5 more authors.. (1991) Investigation of the solution structure of the human parathyroid hormone fragment (1-34) by 1H NMR spectroscopy, distance geometry, and molecular dynamics calculations.. Biochemistry, (16): [PMID:2069952] |
| 5. Arnold, A A and 5 more authors.. (1990) Mutation of the signal peptide-encoding region of the preproparathyroid hormone gene in familial isolated hypoparathyroidism.. The Journal of clinical investigation, [PMID:2212001] |
| 6. Tregear, G W GW and 7 more authors.. (1974) Solid-phase synthesis of the biologically active N-terminal 1 - 34 peptide of human parathyroid hormone.. Hoppe-Seyler's Zeitschrift fur physiologische Chemie, [PMID:4474131] |
| 7. Niall, H D HD and 7 more authors.. (1974) The amino-acid sequence of the amino-terminal 37 residues of human parathyroid hormone.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:4521809] |
| 8. Andreatta, R H RH and 7 more authors.. (1973) [Synthesis of sequence 1-34 of human parathyroid hormone].. Helvetica chimica acta, [PMID:4721748] |
| 9. Jacobs, J W JW, Kemper, B B, Niall, H D HD, Habener, J F JF and Potts, J T JT.. (1974) Structural analysis of human proparathyroid hormone by a new microsequencing approach.. Nature, (10): [PMID:4833516] |
| 10. Vasicek, T J TJ and 7 more authors.. (1983) Nucleotide sequence of the human parathyroid hormone gene.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:6220408] |
| 11. Hendy, G N GN, Kronenberg, H M HM, Potts, J T JT and Rich, A A.. (1981) Nucleotide sequence of cloned cDNAs encoding human preproparathyroid hormone.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:6950381] |
| 12. Marx, U C UC and 9 more authors.. (1995) Structure of human parathyroid hormone 1-37 in solution.. The Journal of biological chemistry, (23): [PMID:7797503] |
| 13. Karaplis, A C AC, Lim, S K SK, Baba, H H, Arnold, A A and Kronenberg, H M HM.. (1995) Inefficient membrane targeting, translocation, and proteolytic processing by signal peptidase of a mutant preproparathyroid hormone protein.. The Journal of biological chemistry, (27): [PMID:7829495] |
| 14. Barden, J A JA and Cuthbertson, R M RM.. (1993) Stabilized NMR structure of human parathyroid hormone(1-34).. European journal of biochemistry, (15): [PMID:8344299] |
| 15. Sunthornthepvarakul, T T, Churesigaew, S S and Ngowngarmratana, S S.. (1999) A novel mutation of the signal peptide of the preproparathyroid hormone gene associated with autosomal recessive familial isolated hypoparathyroidism.. The Journal of clinical endocrinology and metabolism, [PMID:10523031] |
| 16. Marx, U C UC, Adermann, K K, Bayer, P P, Forssmann, W G WG and Rösch, P P.. (2000) Solution structures of human parathyroid hormone fragments hPTH(1-34) and hPTH(1-39) and bovine parathyroid hormone fragment bPTH(1-37).. Biochemical and biophysical research communications, (7): [PMID:10623601] |
| 17. Jin, L L and 8 more authors.. (2000) Crystal structure of human parathyroid hormone 1-34 at 0.9-A resolution.. The Journal of biological chemistry, (1): [PMID:10837469] |
| 18. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 19. Datta, Rupak R, Waheed, Abdul A, Shah, Gul N GN and Sly, William S WS.. (2007) Signal sequence mutation in autosomal dominant form of hypoparathyroidism induces apoptosis that is corrected by a chemical chaperone.. Proceedings of the National Academy of Sciences of the United States of America, (11): [PMID:18056632] |
| 20. Zoidis, E E, Ghirlanda-Keller, C C and Schmid, C C.. (2011) Stimulation of glucose transport in osteoblastic cells by parathyroid hormone and insulin-like growth factor I.. Molecular and cellular biochemistry, [PMID:21076856] |
