Recombinant Human Parvalbumin Protein

Features and benefits

Item Number

rp156672

Grouped product items
SKU	Size	Availability	Price
rp156672-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	In stock	$59.90
rp156672-50μg	50μg	In stock	$139.90
rp156672-100μg	100μg	In stock	$219.90
rp156672-1mg	1mg	In stock	$2,599.90

Carrier Free, >90%(SDS-PAGE), E.coli, C-His tag, 1-110 aa

View related series

Basic Description

Product Name	Recombinant Human Parvalbumin Protein
Synonyms	PVALB Protein; Parvalbumin Alpha; D22S749; MGC116759
Grade	Azide Free, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description：Parvalbumin α (PVALB) is a member of the parvalbumin family. PVALB is a high affinity calcium ion-binding protein, with two EF hand domains. PVALB is structurally and functionally similar to calmodulin and troponin C, it can bind two calcium ions. Parvalbumin is thought to be involved in relaxation after contraction in muscle. Parvalbumin is expressed in a specific population of GABAergic interneurons, which are believed to have a role in maintaining the balance between excitation and inhibition in the cortex as well as the hippocampus.
Specifications & Purity	Carrier Free, Azide Free, ≥90%(SDS-PAGE)
Endotoxin Concentration	<1 EU/μg
Expression System	E. coli
Amino Acids	1-110 aa
Sequence	MGMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESHHHHH
Protein Tag	C-His
Predicted molecular weight	13.1 kDa
SDS-PAGE	11.6 kDa, reducing conditions; 11.6 kDa, non-reducing conditions

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Certificates

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

5 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101805	Certificate of Analysis	Dec 01, 2023	rp156672
ZJ23F1101804	Certificate of Analysis	Dec 01, 2023	rp156672
ZJ23F1101803	Certificate of Analysis	Dec 01, 2023	rp156672
ZJ23F1101802	Certificate of Analysis	Dec 01, 2023	rp156672
ZJ23R1100151	Certificate of Analysis	Nov 15, 2023	rp156672

References

1. and Berchtold, M W MW.. (1989) Parvalbumin genes from human and rat are identical in intron/exon organization and contain highly homologous regulatory elements and coding sequences.. Journal of molecular biology, (5): [PMID:2614829]
2. Föhr, U G UG and 8 more authors.. (1993) Human alpha and beta parvalbumins. Structure and tissue-specific expression.. European journal of biochemistry, (1): [PMID:8354278]
3. Troxler, H H, Kuster, T T, Rhyner, J A JA, Gehrig, P P and Heizmann, C W CW.. (1999) Electrospray ionization mass spectrometry: analysis of the Ca2+-binding properties of human recombinant alpha-parvalbumin and nine mutant proteins.. Analytical biochemistry, (1): [PMID:10036163]
4. Dunham, I I and 24 more authors.. (1999) The DNA sequence of human chromosome 22.. Nature, (2): [PMID:10591208]

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description