Skip to the beginning of the images gallery

Recombinant Human PCNA Protein, >95% (SDS-PAGE), high purity

Animal Free

Carrier Free

Azide Free

≥95%(SDS-PAGE)

Features and benefits

Expression System: E. coli
Protein Tag: N-His

Item Number

rp149860

Grouped product items
SKU	Size	Availability	Price
rp149860-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	In stock	$99.90
rp149860-50μg	50μg	In stock	$199.90
rp149860-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$299.90
rp149860-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,599.90

Animal Free, >95% (SDS-PAGE), E.coli, His tag, 1-261 aa

View related series

Click to view protein information: PCNA

Accession#:P12004 Gene ID:5111 PCNA

Basic Description

Product Name	Recombinant Human PCNA Protein, >95% (SDS-PAGE), high purity
Synonyms	PCNA, Cyclin, Proliferating cell nuclear antigen \| ATLD2 \| cb16 \| DNA polymerase delta auxiliary protein \| etID36690.10 \| fa28e03 \| fb36g03 \| HGCN8729 \| MGC8367 \| Mutagen-sensitive 209 protein \| OTTHUMP00000030189 \| OTTHUMP00000030190 \| Pcna/cyclin \| PCNA
Grade	Animal Free, Azide Free, Carrier Free
Product Description	Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining. Function: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. Has to be loaded onto DNA in order to be able to stimulate APEX2. Description: Proliferating Cell Nuclear Antigen (PCNA) is a protein only expressed in normal proliferate cells and cancer cells. It is central to both DNA replication and repair. One of the well-established functions for PCNA is its role as the processivity factor for DNA polymerase delta and epsilon. PCNA tethers the polymerase catalytic unit to the DNA template for rapid and processive DNA synthesis. Two forms of PCNA exist in cells: (i) a detergent-insoluble trimeric form stably associated with the replicating forks during S phase and (ii) a soluble form in quiescent cells in G1 and G2 phases. PCNA forms a toroidal trimer in S phase with replication factor-C (RF-C) and DNA in an ATP-dependent manner and enables the loading of DNA polymerase delta and epsilon onto the complex. The close association of PCNA with kinase complexes involved in cell cycle machinery indicates that PCNA has a regulatory role in cell cycle progression. PCNA also participates in the processing of branched intermediates that arise during the lagging strand DNA synthesis.
Specifications & Purity	Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Expression System	E. coli
Species	Human
Amino Acids	1-261aa
Sequence	MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Protein Tag	N-His
Predicted molecular weight	32.3 kDa
SDS-PAGE	35.9 kDa, reducing conditions；35.9 kDa，non-reducing condition
Note	20μg卖完停产，不再备货

Images

Recombinant PCNA protein (rp149860) - SDS-PAGE
Recombinant PCNA protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 35.9 kDa.

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F1101733	Certificate of Analysis	Nov 20, 2023	rp149860
ZJ23F1101732	Certificate of Analysis	Nov 20, 2023	rp149860
ZJ23R1100131	Certificate of Analysis	Nov 14, 2023	rp149860

FAQs and Articles

FAQ

Aladdin® Target Proteins

Categories: Technical articles

Tags:

Cytokines Drug development Target Proteins Drug Targets Receptors Immune Checkpoints Cell Surface Markers Signaling Pathways

References

1. Francis Impens,Lilliana Radoshevich,Pascale Cossart,David Ribet. (2014-08-13) Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proceedings of the National Academy of Sciences of the United States of America, 111 ((34)): (12432-12437). [PMID:25114211]
2. Travali, S S and 5 more authors.. (1989) Structure of the human gene for the proliferating cell nuclear antigen.. The Journal of biological chemistry, (5): [PMID:2565339]
3. Prelich, G G, Kostura, M M, Marshak, D R DR, Mathews, M B MB and Stillman, B B.. (1987) The cell-cycle regulated proliferating cell nuclear antigen is required for SV40 DNA replication in vitro.. Nature, [PMID:2882422]
4. Gulbis, J M JM, Kelman, Z Z, Hurwitz, J J, O'Donnell, M M and Kuriyan, J J.. (1996) Structure of the C-terminal region of p21(WAF1/CIP1) complexed with human PCNA.. Cell, (18): [PMID:8861913]
5. Chuang, L S LS and 5 more authors.. (1997) Human DNA-(cytosine-5) methyltransferase-PCNA complex as a target for p21WAF1.. Science (New York, N.Y.), (26): [PMID:9302295]
6. Gary, R R, Ludwig, D L DL, Cornelius, H L HL, MacInnes, M A MA and Park, M S MS.. (1997) The DNA repair endonuclease XPG binds to proliferating cell nuclear antigen (PCNA) and shares sequence elements with the PCNA-binding regions of FEN-1 and cyclin-dependent kinase inhibitor p21.. The Journal of biological chemistry, (26): [PMID:9305916]
7. Saha, P P and 7 more authors.. (1998) Human CDC6/Cdc18 associates with Orc1 and cyclin-cdk and is selectively eliminated from the nucleus at the onset of S phase.. Molecular and cellular biology, [PMID:9566895]
8. Law, B K BK and 6 more authors.. (2000) Salicylate-induced growth arrest is associated with inhibition of p70s6k and down-regulation of c-myc, cyclin D1, cyclin A, and proliferating cell nuclear antigen.. The Journal of biological chemistry, (8): [PMID:10993886]
9. Tsuchimoto, D D and 6 more authors.. (2001) Human APE2 protein is mostly localized in the nuclei and to some extent in the mitochondria, while nuclear APE2 is partly associated with proliferating cell nuclear antigen.. Nucleic acids research, (1): [PMID:11376153]
10. Ducoux, M M and 6 more authors.. (2001) Mediation of proliferating cell nuclear antigen (PCNA)-dependent DNA replication through a conserved p21(Cip1)-like PCNA-binding motif present in the third subunit of human DNA polymerase delta.. The Journal of biological chemistry, (28): [PMID:11595739]
11. Haracska, Lajos L and 6 more authors.. (2002) Stimulation of DNA synthesis activity of human DNA polymerase kappa by PCNA.. Molecular and cellular biology, [PMID:11784855]
12. Liu, Li L, Rodriguez-Belmonte, Esther M EM, Mazloum, Nayef N, Xie, Bin B and Lee, Marietta Y W T MY.. (2003) Identification of a novel protein, PDIP38, that interacts with the p50 subunit of DNA polymerase delta and proliferating cell nuclear antigen.. The Journal of biological chemistry, (21): [PMID:12522211]
13. Fujita, Kiyoko K and 9 more authors.. (2003) Terminal deoxynucleotidyltransferase forms a ternary complex with a novel chromatin remodeling protein with 82 kDa and core histone.. Genes to cells : devoted to molecular & cellular mechanisms, [PMID:12786946]
14. Kannouche, Patricia L PL, Wing, Jonathan J and Lehmann, Alan R AR.. (2004) Interaction of human DNA polymerase eta with monoubiquitinated PCNA: a possible mechanism for the polymerase switch in response to DNA damage.. Molecular cell, (21): [PMID:15149598]
15. Dzantiev, Leonid L and 5 more authors.. (2004) A defined human system that supports bidirectional mismatch-provoked excision.. Molecular cell, (2): [PMID:15225546]
16. Poot, Raymond A RA and 8 more authors.. (2004) The Williams syndrome transcription factor interacts with PCNA to target chromatin remodelling by ISWI to replication foci.. Nature cell biology, [PMID:15543136]
17. Sakurai, Shigeru S and 9 more authors.. (2005) Structural basis for recruitment of human flap endonuclease 1 to PCNA.. The EMBO journal, (23): [PMID:15616578]
18. Li, Hao H and 8 more authors.. (2006) Functional roles of p12, the fourth subunit of human DNA polymerase delta.. The Journal of biological chemistry, (26): [PMID:16510448]
19. Jin, Jianping J, Arias, Emily E EE, Chen, Jing J, Harper, J Wade JW and Walter, Johannes C JC.. (2006) A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.. Molecular cell, (1): [PMID:16949367]
20. Unk, Ildiko I and 9 more authors.. (2006) Human SHPRH is a ubiquitin ligase for Mms2-Ubc13-dependent polyubiquitylation of proliferating cell nuclear antigen.. Proceedings of the National Academy of Sciences of the United States of America, (28): [PMID:17108083]
21. Wang, Shao-Chun SC and 10 more authors.. (2006) Tyrosine phosphorylation controls PCNA function through protein stability.. Nature cell biology, [PMID:17115032]
22. Motegi, Akira A and 5 more authors.. (2006) Human SHPRH suppresses genomic instability through proliferating cell nuclear antigen polyubiquitination.. The Journal of cell biology, (4): [PMID:17130289]
23. Unk, Ildiko I and 7 more authors.. (2008) Human HLTF functions as a ubiquitin ligase for proliferating cell nuclear antigen polyubiquitination.. Proceedings of the National Academy of Sciences of the United States of America, (11): [PMID:18316726]
24. Farina, Andrea A and 6 more authors.. (2008) Studies with the human cohesin establishment factor, ChlR1. Association of ChlR1 with Ctf18-RFC and Fen1.. The Journal of biological chemistry, (25): [PMID:18499658]
25. Nishitani, Hideo H and 5 more authors.. (2008) CDK inhibitor p21 is degraded by a proliferating cell nuclear antigen-coupled Cul4-DDB1Cdt2 pathway during S phase and after UV irradiation.. The Journal of biological chemistry, (24): [PMID:18703516]
26. Motegi, Akira A and 10 more authors.. (2008) Polyubiquitination of proliferating cell nuclear antigen by HLTF and SHPRH prevents genomic instability from stalled replication forks.. Proceedings of the National Academy of Sciences of the United States of America, (26): [PMID:18719106]
27. Abbas, Tarek T and 5 more authors.. (2008) PCNA-dependent regulation of p21 ubiquitylation and degradation via the CRL4Cdt2 ubiquitin ligase complex.. Genes & development, (15): [PMID:18794347]
28. Zhang, Sufang S and 5 more authors.. (2008) PCNA is ubiquitinated by RNF8.. Cell cycle (Georgetown, Tex.), (1): [PMID:18948756]
29. Yu, Yu Y and 13 more authors.. (2009) Proliferating cell nuclear antigen is protected from degradation by forming a complex with MutT Homolog2.. The Journal of biological chemistry, (17): [PMID:19419956]
30. Burkovics, Peter P, Hajdú, Ildikó I, Szukacsov, Valéria V, Unk, Ildiko I and Haracska, Lajos L.. (2009) Role of PCNA-dependent stimulation of 3'-phosphodiesterase and 3'-5' exonuclease activities of human Ape2 in repair of oxidative DNA damage.. Nucleic acids research, [PMID:19443450]
31. Moldovan, George-Lucian GL and 5 more authors.. (2010) DNA polymerase POLN participates in cross-link repair and homologous recombination.. Molecular and cellular biology, [PMID:19995904]
32. Terai, Kenta K, Abbas, Tarek T, Jazaeri, Amir A AA and Dutta, Anindya A.. (2010) CRL4(Cdt2) E3 ubiquitin ligase monoubiquitinates PCNA to promote translesion DNA synthesis.. Molecular cell, (15): [PMID:20129063]
33. Ogi, Tomoo T and 13 more authors.. (2010) Three DNA polymerases, recruited by different mechanisms, carry out NER repair synthesis in human cells.. Molecular cell, (12): [PMID:20227374]
34. De Haro, Leyma P LP and 9 more authors.. (2010) Metnase promotes restart and repair of stalled and collapsed replication forks.. Nucleic acids research, [PMID:20457750]
35. Groehler, Angela L AL and Lannigan, Deborah A DA.. (2010) A chromatin-bound kinase, ERK8, protects genomic integrity by inhibiting HDM2-mediated degradation of the DNA clamp PCNA.. The Journal of cell biology, (23): [PMID:20733054]
36. Rowbotham, Samuel P SP and 12 more authors.. (2011) Maintenance of silent chromatin through replication requires SWI/SNF-like chromatin remodeler SMARCAD1.. Molecular cell, (6): [PMID:21549307]
37. Emanuele, Michael J MJ, Ciccia, Alberto A, Elia, Andrew E H AE and Elledge, Stephen J SJ.. (2011) Proliferating cell nuclear antigen (PCNA)-associated KIAA0101/PAF15 protein is a cell cycle-regulated anaphase-promoting complex/cyclosome substrate.. Proceedings of the National Academy of Sciences of the United States of America, (14): [PMID:21628590]
38. Rahmeh, Amal A AA and 5 more authors.. (2012) Phosphorylation of the p68 subunit of Pol δ acts as a molecular switch to regulate its interaction with PCNA.. Biochemistry, (10): [PMID:22148433]
39. Moldovan, George-Lucian GL and 6 more authors.. (2012) Inhibition of homologous recombination by the PCNA-interacting protein PARI.. Molecular cell, (13): [PMID:22153967]
40. Punchihewa, Chandanamali C and 14 more authors.. (2012) Identification of small molecule proliferating cell nuclear antigen (PCNA) inhibitor that disrupts interactions with PIP-box proteins and inhibits DNA replication.. The Journal of biological chemistry, (20): [PMID:22383522]
41. Din, Farhat V N FV and 7 more authors.. (2012) Aspirin inhibits mTOR signaling, activates AMP-activated protein kinase, and induces autophagy in colorectal cancer cells.. Gastroenterology, [PMID:22406476]
42. Arboleda, Valerie A VA and 14 more authors.. (2012) Mutations in the PCNA-binding domain of CDKN1C cause IMAGe syndrome.. Nature genetics, (27): [PMID:22634751]
43. Centore, Richard C RC, Yazinski, Stephanie A SA, Tse, Alice A and Zou, Lee L.. (2012) Spartan/C1orf124, a reader of PCNA ubiquitylation and a regulator of UV-induced DNA damage response.. Molecular cell, (8): [PMID:22681887]
44. Ciccia, Alberto A and 12 more authors.. (2012) Polyubiquitinated PCNA recruits the ZRANB3 translocase to maintain genomic integrity after replication stress.. Molecular cell, (10): [PMID:22704558]
45. Yuan, Jingsong J, Ghosal, Gargi G and Chen, Junjie J.. (2012) The HARP-like domain-containing protein AH2/ZRANB3 binds to PCNA and participates in cellular response to replication stress.. Molecular cell, (10): [PMID:22705370]
46. Weston, Ria R, Peeters, Hanneke H and Ahel, Dragana D.. (2012) ZRANB3 is a structure-specific ATP-dependent endonuclease involved in replication stress response.. Genes & development, (15): [PMID:22759634]
47. Povlsen, Lou K LK and 9 more authors.. (2012) Systems-wide analysis of ubiquitylation dynamics reveals a key role for PAF15 ubiquitylation in DNA-damage bypass.. Nature cell biology, [PMID:23000965]
48. Bacquin, Agathe A and 8 more authors.. (2013) The helicase FBH1 is tightly regulated by PCNA via CRL4(Cdt2)-mediated proteolysis in human cells.. Nucleic acids research, [PMID:23677613]
49. Menning, Maureen M and Kufer, Thomas A TA.. (2013) A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.. FEBS letters, (11): [PMID:23711367]
50. Vannier, Jean-Baptiste JB and 6 more authors.. (2013) RTEL1 is a replisome-associated helicase that promotes telomere and genome-wide replication.. Science (New York, N.Y.), (11): [PMID:24115439]
51. Alabert, Constance C and 9 more authors.. (2014) Nascent chromatin capture proteomics determines chromatin dynamics during DNA replication and identifies unknown fork components.. Nature cell biology, [PMID:24561620]
52. Nicolae, Claudia M CM and 6 more authors.. (2014) The ADP-ribosyltransferase PARP10/ARTD10 interacts with proliferating cell nuclear antigen (PCNA) and is required for DNA damage tolerance.. The Journal of biological chemistry, (9): [PMID:24695737]
53. Baple, Emma L EL and 21 more authors.. (2014) Hypomorphic PCNA mutation underlies a human DNA repair disorder.. The Journal of clinical investigation, [PMID:24911150]
54. Cazzalini, Ornella O and 11 more authors.. (2014) CBP and p300 acetylate PCNA to link its degradation with nucleotide excision repair synthesis.. Nucleic acids research, [PMID:24939902]
55. Perry, J Jefferson P JJ and 5 more authors.. (2015) Human C6orf211 encodes Armt1, a protein carboxyl methyltransferase that targets PCNA and is linked to the DNA damage response.. Cell reports, (3): [PMID:25732820]
56. Hendriks, Ivo A; Treffers, Louise W; Verlaan-de Vries, Matty; Olsen, Jesper V and Vertegaal, Alfred C O.. (2015) SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.. Cell reports, (17): [PMID:25772364]
57. Sun, Zhiguo Z, Jha, Hem Chandra HC and Robertson, Erle S ES.. (2015) Bub1 in Complex with LANA Recruits PCNA To Regulate Kaposi's Sarcoma-Associated Herpesvirus Latent Replication and DNA Translesion Synthesis.. Journal of virology, [PMID:26223641]
58. Fu, Dragony D, Samson, Leona D LD, Hübscher, Ullrich U and van Loon, Barbara B.. (2015) The interaction between ALKBH2 DNA repair enzyme and PCNA is direct, mediated by the hydrophobic pocket of PCNA and perturbed in naturally-occurring ALKBH2 variants.. DNA repair, [PMID:26408825]
59. Hoffmann, Saskia S and 13 more authors.. (2016) TRAIP is a PCNA-binding ubiquitin ligase that protects genome stability after replication stress.. The Journal of cell biology, (4): [PMID:26711499]
60. Wang, Yong Y, Xu, Min M and Jiang, Tao T.. (2016) Crystal structure of human PCNA in complex with the PIP box of DVC1.. Biochemical and biophysical research communications, (27): [PMID:27084448]
61. Feng, Wanjuan and 5 more authors.. (2016) TRAIP regulates replication fork recovery and progression via PCNA.. Cell discovery, [PMID:27462463]
62. Jo, Ukhyun U and 5 more authors.. (2016) PCNA-Dependent Cleavage and Degradation of SDE2 Regulates Response to Replication Stress.. PLoS genetics, [PMID:27906959]
63. Reynolds, John J JJ and 61 more authors.. (2017) Mutations in DONSON disrupt replication fork stability and cause microcephalic dwarfism.. Nature genetics, [PMID:28191891]
64. Chen, Wanbiao W and 5 more authors.. (2017) Structure insights into the molecular mechanism of the interaction between UHRF2 and PCNA.. Biochemical and biophysical research communications, (16): [PMID:28951215]
65. Kottemann, Molly C MC, Conti, Brooke A BA, Lach, Francis P FP and Smogorzewska, Agata A.. (2018) Removal of RTF2 from Stalled Replisomes Promotes Maintenance of Genome Integrity.. Molecular cell, (4): [PMID:29290612]
66. Almendral, J M JM, Huebsch, D D, Blundell, P A PA, Macdonald-Bravo, H H and Bravo, R R.. (1987) Cloning and sequence of the human nuclear protein cyclin: homology with DNA-binding proteins.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2882507]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.