Recombinant Human PDGFC Protein, ≥95% (SDS-PAGE), high purity

Item Number

rp149966

• Product Name: Recombinant Human PDGFC Protein, ≥95% (SDS-PAGE), high purity
• Synonyms: Fallotein; HSCDGF; PDGF-C; PDGFC; PDGFC latent form; PDGFC receptor-binding form; PDGFC_HUMAN; Platelet derived growth factor C; Platelet-derived growth factor C, receptor-binding form; SCDGF; Secretory growth factor like protein; Secretory growth factor
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
• Purity: ≥95% (SDS-PAGE)
• Bioactivity: Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is typically 0.5-3 μg/mL.
• Endotoxin Concentration: <0.1 EU/μg
• Expression System: HEK293
• Species: Human
• Amino Acids: 235-345 aa
• Sequence: MPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHHVVDLNLLTEEVRLYSCT
• Protein Tag: N-Fc & His
• Accession #: Q9NRA1
• Predicted molecular weight: 40 kDa

Product Description

Purity
≥95% (SDS-PAGE)
Endotoxin level
<0.1 EU/μg
Function
Potent mitogen and chemoattractant for cells of mesenchymal origin. Binding of this growth factor to its affinity receptor elicits a variety of cellular responses. Appears to be involved in the three stages of wound healing: inflammation, proliferation and remodeling. Involved in fibrotic processes, in which transformation of interstitial fibroblasts into myofibroblasts plus collagen deposition occurs. Acts as a specific ligand for alpha platelet-derived growth factor receptor homodimer, and alpha and beta heterodimer. Binding to receptors induces their activation by tyrosine phosphorylation. The CUB domain has mitogenic activity in coronary artery smooth muscle cells, suggesting a role beyond the maintainance of the latency of the PDGF domain. In the nucleus, PDGFC seems to have additional function. Seems to be involved in palatogenesis.