| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp184931-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $189.90 | |
| rp184931-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $489.90 | |
| rp184931-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $769.90 | |
| rp184931-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $839.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, C-His tag, 1-209 aa
| Product Name | Recombinant Human PGPEP-1 Protein |
|---|---|
| Synonyms | EC 3.4.19.3 | PAP-I | Pcp | PGPEP1 | PGPEP-1 | PGPIFLJ20208 | PGP-IPAP-I | PGPMGC10812 | Pyroglutamyl aminopeptidase I | pyroglutamyl-peptidase 1 | pyroglutamyl-peptidase I5-oxoprolyl-peptidase | Pyrrolidone-carboxylate peptidase |
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | Pyroglutamyl peptidase-1 (PGPEP-1) is an omega peptidase which removes pyroglutamyl residues from the amino termini of peptides and proteins. It is a cytosolic cysteine peptidase that is expressed in most cell types. The enzyme requires a thiol‑reducing a |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 1-209 aa |
| Sequence | MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHSPQLVVHVGVSGMATTVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSIIDMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQLGRALRAIIEEMLDLLEQSEGKINYCHKHHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 23.9 kDa |
| SDS-PAGE | 25.1 kDa, under reducing conditions; 25.4 kDa, under non-reducing conditions |
Recombinant Human PGPEP-1 Protein (rp184931) - SDS-PAGE
3μg/lane of Recombinant Human PGPEP-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 25.1 kDa under reducing conditions and 25.4 kDa under non-reducing conditions.
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
|---|---|
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
