Recombinant Human Poliovirus Receptor/PVR Protein, ≥95% (SDS-PAGE), high purity

Item Number

rp150374

• Product Name: Recombinant Human Poliovirus Receptor/PVR Protein, ≥95% (SDS-PAGE), high purity
• Synonyms: CD155 CD155 antigen FLJ25946 HVED mE4 NECL 5 Necl-5 Necl5 Nectin like 5 Nectin like protein 5 Nectin-like protein 5 Ortholog of mouse Tage4 Poliovirus receptor PVR PVR_HUMAN PVS Taa1 Tage 4 TAGE4
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: ≥95% (SDS-PAGE)
• Bioactivity: Immobilized Human TIGIT (rp152378) at 1.5 μg/mL can bind Recombinant Human Poliovirus Receptor/PVR Protein (rp150374) with a linear range of 0.15 - 1.2 μg/mL.
• Endotoxin Concentration: ＜0.1 EU/μg
• Expression System: HEK293
• Species: Human
• Amino Acids: 28-343 aa
• Sequence: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTT
• Protein Tag: C-hFc & His
• Accession #: P15151
• Predicted molecular weight: 62.5 kDa
• SDS-PAGE: 96.1 kDa, under reducing conditions ; 204.4 kDa, under non-reducing conditions.

Product Description

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse between NK cell and target cell. This may trigger adhesion and secretion of lytic granules and IFN-gamma and activate cytoxicity of activated NK cells. May also promote NK cell-target cell modular exchange, and PVR transfer to the NK cell. This transfer is more important in some tumor cells expressing a lot of PVR, and may trigger fratricide NK cell activation, providing tumors with a mechanism of immunoevasion. Plays a role in mediating tumor cell invasion and migration. Serves as a receptor for poliovirus attachment to target cells. May play a role in axonal transport of poliovirus, by targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1. This interaction would drive the virus-containing vesicle to the axonal retrograde transport.