| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183752-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp183752-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $339.90 | |
| rp183752-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,699.90 |
Carrier Free, >95% (SDS-PAGE), E. coli, N-His tag, 2-140 aa
| Product Name | Recombinant Human Profilin 1 Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Actin binding protein | ALS18 | Epididymis tissue protein Li 184a | OTTHUMP00000125244 | Pfn | PFN 1 | PFN1 | PROF1_HUMAN | Profilin I | Profilin-1 | Profilin1 | ProfilinI |
| Grade | Azide Free, Carrier Free |
| Product Description |
Purity: >95%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | >95% (SDS-PAGE) |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-140 aa |
| Sequence | MHHHHHHAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
| Protein Tag | N-His |
| Predicted molecular weight | 15.9 kDa |
| SDS-PAGE | 13.8 kDa, under reducing conditions; 13.8 kDa, under non-reducing conditions |
Recombinant Human Profilin 1 Protein (rp183752) - SDS-PAGE
2 μg/lane of Recombinant Human Profilin 1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.8 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505383 | Certificate of Analysis | May 15, 2024 | rp183752 |
| ZJ24F0505382 | Certificate of Analysis | May 15, 2024 | rp183752 |
| ZJ24F0505381 | Certificate of Analysis | May 15, 2024 | rp183752 |
