| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp150679-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $79.90 | |
| rp150679-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $339.90 | |
| rp150679-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $599.90 | |
| rp150679-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,699.90 |
Animal Free, >96% (SDS-PAGE&HPLC), Active, E.coli, No tag, 33-168 aa
| Product Name | Recombinant Human PTN Protein, ＞96% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | HARP; HBBM; HB-GAM; HBGF8; HBNF; HBNF1; HBNF-1; Heparin-binding brain mitogen; HNGF-8; NEGF1HBGF-8; neurite growth-promoting factor 1; neurite growth-promoting factor1); OSF-1; Osteoblast-specific factor 1; Pleiotrophin; PTN; HBGAM; heparin affin regulato |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥96%(SDS-PAGE&HPLC) |
| Purity | ＞96% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been pre-coated wi |
| Endotoxin Concentration | < 0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 33-168 aa |
| Sequence | GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD |
| Protein Tag | No tag |
| Predicted molecular weight | 15.3 kDa |
| SDS-PAGE | 15.3 kDa |
Recombinant Human PTN Protein (rp150679) - Protein Bioactivity
Fully biologically active when compared to standard. The biological activity was measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons, when neurons were plated on 96 well culture plates that had been pre-coated with 100 µL/well of a solution of 5-10 µg/mL PTN.
Recombinant Human PTN Protein (rp150679) - SDS-PAGE
Recombinant Human PTN Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.8 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be app |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20 ℃ long term (12 months). Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0800866 | Certificate of Analysis | Jun 25, 2024 | rp150679 |
| ZJ23F0800867 | Certificate of Analysis | Jun 25, 2024 | rp150679 |
| ZJ23F0800868 | Certificate of Analysis | Jun 25, 2024 | rp150679 |
