| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp150830-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp150830-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $379.90 | |
| rp150830-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $609.90 | |
| rp150830-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,959.90 |
Animal Free, >90%(SDS-PAGE), Active, 293F, Fc & His tag, 24-344 aa
| Product Name | Recombinant Human RAGE Protein, ＞90%(SDS-PAGE), high purity |
|---|---|
| Synonyms | advanced glycosylation end product-specific receptor; AGER; RAGE isoform delta; RAGE isoform sRAGE-delta; RAGE; Receptor for advanced glycosylation end products; receptor for advanced glycosylation end-products; SCARJ1; sRAGE |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity ＞90% SDS-PAGE. Function Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling (By similarity). Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥90%(SDS-PAGE) |
| Purity | ＞90%(SDS-PAGE) |
| Bioactivity | Recombinant human HMGB1 at 2 μg/mL (100 μL/well) can bind Recombinant human AGER with a linear range of 15-50 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 24-344 aa |
| Sequence | QNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPL |
| Protein Tag | C-Fc & His |
| Accession # | Q15109 |
| Predicted molecular weight | 63 kDa |
Recombinant Human RAGE Protein (rp150830) - Protein Bioactivity
Recombinant human HMGB1 at 2.0 μg/mL can bind Recombinant Human RAGE Protein (rp150830) with a linear range of 15.0 -50.0 ng/mL. The EC₅₀ for this effect is 70.0 ng/mL.
Recombinant Human RAGE Protein (rp150830) - SDS-PAGE
3 μg/lane of Recombinant Human RAGE was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing the band at 77.1 & 38.1 kDa under reducing conditions.
.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505697 | Certificate of Analysis | May 24, 2024 | rp150830 |
| ZJ24F0505698 | Certificate of Analysis | May 24, 2024 | rp150830 |
| ZJ24F0505699 | Certificate of Analysis | May 24, 2024 | rp150830 |
| 1. Neeper M, Schmidt AM, Brett J, Yan SD, Wang F, Pan YC, Elliston K, Stern D, Shaw A. (1992) Cloning and expression of a cell surface receptor for advanced glycosylation end products of proteins.. J Biol Chem, 267 (21): (14998-5004). [PMID:1378843] |
| 2. Saito S, Ihara M. (2014) New therapeutic approaches for Alzheimer's disease and cerebral amyloid angiopathy.. Front Aging Neurosci, 6 (3): (290). [PMID:25368578] |
| 3. Bongarzone S, Savickas V, Luzi F, Gee AD. (2017) Targeting the Receptor for Advanced Glycation Endproducts (RAGE): A Medicinal Chemistry Perspective.. J Med Chem, 60 (17): (7213-7232). [PMID:28482155] |
| 4. Cherilyn M Sirois,Tengchuan Jin,Allison L Miller,Damien Bertheloot,Hirotaka Nakamura,Gabor L Horvath,Abubakar Mian,Jiansheng Jiang,Jacob Schrum,Lukas Bossaller,Karin Pelka,Natalio Garbi,Yambasu Brewah,Jane Tian,ChewShun Chang,Partha S Chowdhury,Gary P Sims,Roland Kolbeck,Anthony J Coyle,Alison A Humbles,T Sam Xiao,Eicke Latz. (2013-10-02) RAGE is a nucleic acid receptor that promotes inflammatory responses to DNA.. The Journal of experimental medicine, 210 ((11)): (2447-2463). [PMID:24081950] |
| 5. Han YT, Kim K, Choi GI, An H, Son D, Kim H, Ha HJ, Son JH, Chung SJ, Park HJ, Lee J, Suh YG.. (2014) Pyrazole-5-carboxamides, novel inhibitors of receptor for advanced glycation end products (RAGE).. Eur J Med Chem, 79 (128-142). [PMID:24727489] |
| 6. Choi K, Lim KS, Shin J, Kim SH, Suh YG, Hong HS, Kim H, Ha HJ, Kim YH, Lee J, Lee J.. (2015) 6-Phenoxy-2-phenylbenzoxazoles, novel inhibitors of receptor for advanced glycation end products (RAGE).. Bioorg Med Chem, 23 (15): (4919-4935). [PMID:26051601] |
| 7. Sugaya, K K and 7 more authors.. (1994) Three genes in the human MHC class III region near the junction with the class II: gene for receptor of advanced glycosylation end products, PBX2 homeobox gene and a notch homolog, human counterpart of mouse mammary tumor gene int-3.. Genomics, (15): [PMID:7835890] |
| 8. Hudson, B I BI, Stickland, M H MH, Futers, T S TS and Grant, P J PJ.. (2001) Effects of novel polymorphisms in the RAGE gene on transcriptional regulation and their association with diabetic retinopathy.. Diabetes, [PMID:11375354] |
| 9. Yonekura, Hideto H and 12 more authors.. (2003) Novel splice variants of the receptor for advanced glycation end-products expressed in human vascular endothelial cells and pericytes, and their putative roles in diabetes-induced vascular injury.. The Biochemical journal, (15): [PMID:12495433] |
| 10. Xie, Tao T and 7 more authors.. (2003) Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.. Genome research, [PMID:14656967] |
| 11. Hudson, Barry I BI and 7 more authors.. (2008) Identification, classification, and expression of RAGE gene splice variants.. FASEB journal : official publication of the Federation of American Societies for Experimental Biology, [PMID:18089847] |
| 12. Moroz, Olga V OV and 13 more authors.. (2009) Both Ca2+ and Zn2+ are essential for S100A12 protein oligomerization and function.. BMC biochemistry, (23): [PMID:19386136] |
| 13. Fang, Fang F and 11 more authors.. (2010) RAGE-dependent signaling in microglia contributes to neuroinflammation, Abeta accumulation, and impaired learning/memory in a mouse model of Alzheimer's disease.. FASEB journal : official publication of the Federation of American Societies for Experimental Biology, [PMID:19906677] |
| 14. Park, Hajeung H, Adsit, Floyd G FG and Boyington, Jeffrey C JC.. (2010) The 1.5 Å crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.. The Journal of biological chemistry, (24): [PMID:20943659] |
| 15. Koch, Michael M and 6 more authors.. (2010) Structural basis for ligand recognition and activation of RAGE.. Structure (London, England : 1993), (13): [PMID:20947022] |
| 16. Jin, Qing'e Q, Chen, Hongyan H, Luo, Aiping A, Ding, Fang F and Liu, Zhihua Z.. (2011) S100A14 stimulates cell proliferation and induces cell apoptosis at different concentrations via receptor for advanced glycation end products (RAGE).. PloS one, (29): [PMID:21559403] |
| 17. Xue, Jing J and 9 more authors.. (2011) Advanced glycation end product recognition by the receptor for AGEs.. Structure (London, England : 1993), (11): [PMID:21565706] |
| 18. Sakaguchi, Masakiyo M and 8 more authors.. (2011) TIRAP, an adaptor protein for TLR2/4, transduces a signal from RAGE phosphorylated upon ligand binding.. PloS one, [PMID:21829704] |
| 19. Wei, Wen W and 9 more authors.. (2012) Disulfide bonds within the C2 domain of RAGE play key roles in its dimerization and biogenesis.. PloS one, [PMID:23284645] |
| 20. Jules, Joel J, Maiguel, Dony D and Hudson, Barry I BI.. (2013) Alternative splicing of the RAGE cytoplasmic domain regulates cell signaling and function.. PloS one, [PMID:24260107] |
| 21. Shang, Dan and 6 more authors.. (2016) High Mobility Group Box Protein 1 Boosts Endothelial Albumin Transcytosis through the RAGE/Src/Caveolin-1 Pathway.. Scientific reports, (30): [PMID:27572515] |
