| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp150860-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp150860-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $459.90 | |
| rp150860-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $559.90 | |
| rp150860-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, >98%(SDS-PAGE, HPLC), Active, E.coli, No tag, 24-91 aa
| Product Name | Recombinant Human RANTES Protein, ＞98%(SDS-PAGE, HPLC), high purityused for Cell Culture various applications |
|---|---|
| Synonyms | CCL5; chemokine (C-C motif) ligand 5; D17S136Enormally T-expressed, and presumably secreted; EoCP; Eosinophil chemotactic cytokine; RANTES; SISd; SIS-delta; small inducible cytokine A5 (RANTES); small inducible cytokine subfamily A (Cys-Cys), member 5; Sm |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | ＞98%(SDS-PAGE, HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/ml. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 24-91 aa |
| Sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P13501 |
| Source | Recombinant |
| Predicted molecular weight | 7.8 kDa |
| SDS-PAGE | 7.8 kDa |
Recombinant Human RANTES Protein (rp150860)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 1.0-10 ng/mL.
Recombinant Human RANTES Protein (rp150860)-SDS-PAGE
Recombinant Human RANTES Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, Showing a band at 7.8 kDa under reducing conditions and 9.6 kDa under non-reducing conditions.
| Application | Cell Culture |
|---|---|
| Form | Lyophilized |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconst |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600402 | Certificate of Analysis | Mar 26, 2024 | rp150860 |
| ZJ23F0600403 | Certificate of Analysis | Mar 26, 2024 | rp150860 |
| ZJ23F0600404 | Certificate of Analysis | Mar 26, 2024 | rp150860 |
| 1. Ignatov A, Robert J, Gregory-Evans C, Schaller HC. (2006) RANTES stimulates Ca2+ mobilization and inositol trisphosphate (IP3) formation in cells transfected with G protein-coupled receptor 75.. Br J Pharmacol, 149 (5): (490-7). [PMID:17001303] |
| 2. Cocchi F, DeVico AL, Garzino-Demo A, Arya SK, Gallo RC, Lusso P. (1995) Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells.. Science, 270 (5243): (1811-5). [PMID:8525373] |
| 3. Regenass P, Abboud D, Daubeuf F, Lehalle C, Gizzi P, Riché S, Hachet-Haas M, Rohmer F, Gasparik V, Boeglin D et al.. (2018) Discovery of a Locally and Orally Active CXCL12 Neutraligand (LIT-927) with Anti-inflammatory Effect in a Murine Model of Allergic Airway Hypereosinophilia.. J Med Chem, 61 (17): (7671-7686). [PMID:30106292] |
| 4. Wichapong K, Alard JE, Ortega-Gomez A, Weber C, Hackeng TM, Soehnlein O, Nicolaes GA.. (2016) Structure-Based Design of Peptidic Inhibitors of the Interaction between CC Chemokine Ligand 5 (CCL5) and Human Neutrophil Peptides 1 (HNP1).. J Med Chem, 59 (9): (4289-4301). [PMID:26871718] |
| 5. Kameyoshi, Y Y, Dörschner, A A, Mallet, A I AI, Christophers, E E and Schröder, J M JM.. (1992) Cytokine RANTES released by thrombin-stimulated platelets is a potent attractant for human eosinophils.. The Journal of experimental medicine, (1): [PMID:1380064] |
| 6. Schall, T J TJ and 6 more authors.. (1988) A human T cell-specific molecule is a member of a new gene family.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:2456327] |
| 7. Schröder, J M JM, Kameyoshi, Y Y and Christophers, E E.. (1993) Platelets secrete an eosinophil-chemotactic cytokine which is a member of the C-C-chemokine family.. Advances in experimental medicine and biology, [PMID:7524281] |
| 8. Skelton, N J NJ, Aspiras, F F, Ogez, J J and Schall, T J TJ.. (1995) Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.. Biochemistry, (25): [PMID:7537088] |
| 9. Chung, C W CW, Cooke, R M RM, Proudfoot, A E AE and Wells, T N TN.. (1995) The three-dimensional solution structure of RANTES.. Biochemistry, (25): [PMID:7542919] |
| 10. Proost, P P and 9 more authors.. (1998) Amino-terminal truncation of chemokines by CD26/dipeptidyl-peptidase IV. Conversion of RANTES into a potent inhibitor of monocyte chemotaxis and HIV-1-infection.. The Journal of biological chemistry, (27): [PMID:9516414] |
| 11. Wilken, J J and 8 more authors.. (1999) Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.. Chemistry & biology, [PMID:9889151] |
| 12. Nomiyama, H H and 5 more authors.. (1999) Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, HCC-1, LEC, and RANTES.. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research, [PMID:10213461] |
| 13. Lim, Jean K JK, Burns, Jennifer M JM, Lu, Wuyuan W and DeVico, Anthony L AL.. (2005) Multiple pathways of amino terminal processing produce two truncated variants of RANTES/CCL5.. Journal of leukocyte biology, [PMID:15923218] |
| 14. Capoulade-Métay, Corinne C and 10 more authors.. (2006) A natural CCL5/RANTES variant antagonist for CCR1 and CCR3.. Immunogenetics, [PMID:16791620] |
| 15. Lim, Jean K JK, Lu, Wuyuan W, Hartley, Oliver O and DeVico, Anthony L AL.. (2006) N-terminal proteolytic processing by cathepsin G converts RANTES/CCL5 and related analogs into a truncated 4-68 variant.. Journal of leukocyte biology, [PMID:16963625] |
| 16. Caballero-Campo, Pedro P and 5 more authors.. (2014) A role for the chemokine receptor CCR6 in mammalian sperm motility and chemotaxis.. Journal of cellular physiology, [PMID:23765988] |
| 17. Liu, Bo B and 7 more authors.. (2013) The novel chemokine receptor, G-protein-coupled receptor 75, is expressed by islets and is coupled to stimulation of insulin secretion and improved glucose homeostasis.. Diabetologia, [PMID:23979485] |
