My Cart
You have no items in your shopping cart.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp142729-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $49.90 | |
rp142729-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
rp142729-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
rp142729-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $999.90 |
GMP, ≥90% (SDS-PAGE), Active, Oryza sativa, No tag, 1-418 aa
Product Name | Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein, CAS No.9041-92-3 |
---|---|
Synonyms | Alpha-1 protease inhibitor | Alpha-1-antiproteinase | Serpin A1 | A1AT | AAT | MGC23330 | alpha 1-Antitrypsin | alpha 1-Proteinase Inhibitor | Alpha-1 protease inhibitor | Alpha-1-antiproteinase | alpha-1-antitrypsin | antitrypsin), member 1 | member 1 | |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, Low Endotoxin |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Low Endotoxin, ≥90%(SDS-PAGE) |
Biochemical and Physiological Mechanisms | Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in |
Bioactivity | ≥0.70mg active AAT/mg total protein |
Endotoxin Concentration | <1.0 EU/mg |
Expression System | Oryza sativa |
Species | Human |
Amino Acids | 1-418 aa |
Sequence | MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
Protein Tag | No tag |
Accession # | P01009 |
Predicted molecular weight | 46.7 kDa |
Form | Lyophilized |
---|---|
Reconstitution | Reconstitute in sterile PBS to a concentration of 100-200 μg/ml. Further dilutions should be made in appropriate buffered solutions. After reconstitution, store at 4℃ short term (2-7 days), store at -20℃ long term. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20 ℃ for 36 months. Upon delivery aliquot. Avoid freeze/thaw cycle. |
CAS | 9041-92-3 |
1. Niemann, M A MA, Narkates, A J AJ and Miller, E J EJ.. (1992) Isolation and serine protease inhibitory activity of the 44-residue, C-terminal fragment of alpha 1-antitrypsin from human placenta.. Matrix (Stuttgart, Germany), [PMID:1406456] |
2. Wu, Y Y and Foreman, R C RC.. (1991) The molecular genetics of alpha 1 antitrypsin deficiency.. BioEssays : news and reviews in molecular, cellular and developmental biology, [PMID:1859394] |
3. Seyama, K K and 5 more authors.. (1991) Siiyama (serine 53 (TCC) to phenylalanine 53 (TTC)). A new alpha 1-antitrypsin-deficient variant with mutation on a predicted conserved residue of the serpin backbone.. The Journal of biological chemistry, (5): [PMID:1905728] |
4. Tanaka, N N and 5 more authors.. (1991) Characterization of a 54 kDa, alpha 1-antitrypsin-like protein isolated from ascitic fluid of an endometrial cancer patient.. Japanese journal of cancer research : Gann, [PMID:1906855] |
5. Curiel, D T DT, Vogelmeier, C C, Hubbard, R C RC, Stier, L E LE and Crystal, R G RG.. (1990) Molecular basis of alpha 1-antitrypsin deficiency and emphysema associated with the alpha 1-antitrypsin Mmineral springs allele.. Molecular and cellular biology, [PMID:1967187] |
6. Okayama, H H, Brantly, M M, Holmes, M M and Crystal, R G RG.. (1991) Characterization of the molecular basis of the alpha 1-antitrypsin F allele.. American journal of human genetics, [PMID:2035534] |
7. Graham, A A, Kalsheker, N A NA, Bamforth, F J FJ, Newton, C R CR and Markham, A F AF.. (1990) Molecular characterisation of two alpha-1-antitrypsin deficiency variants: proteinase inhibitor (Pi) Null(Newport) (Gly115----Ser) and (Pi) Z Wrexham (Ser-19----Leu).. Human genetics, [PMID:2227940] |
8. Frazier, G C GC, Siewertsen, M A MA, Hofker, M H MH, Brubacher, M G MG and Cox, D W DW.. (1990) A null deficiency allele of alpha 1-antitrypsin, QOludwigshafen, with altered tertiary structure.. The Journal of clinical investigation, [PMID:2254451] |
9. Matsunaga, E E and 5 more authors.. (1990) Molecular analysis of the gene of the alpha 1-antitrypsin deficiency variant, Mnichinan.. American journal of human genetics, [PMID:2309708] |
10. Holmes, M D MD, Brantly, M L ML, Curiel, D T DT, Weidinger, S S and Crystal, R G RG.. (1990) Characterization of the normal alpha 1-antitrypsin allele Vmunich: a variant associated with a unique protein isoelectric focusing pattern.. American journal of human genetics, [PMID:2316526] |
11. Faber, J P JP, Weidinger, S S and Olek, K K.. (1990) Sequence data of the rare deficient alpha 1-antitrypsin variant PI Zaugsburg.. American journal of human genetics, [PMID:2339709] |
12. Holmes, M D MD, Brantly, M L ML, Fells, G A GA and Crystal, R G RG.. (1990) Alpha 1-antitrypsin Wbethesda: molecular basis of an unusual alpha 1-antitrypsin deficiency variant.. Biochemical and biophysical research communications, (16): [PMID:2390072] |
13. Graham, A A and 5 more authors.. (1990) Characterisation of the alpha-1-antitrypsin M3 gene, a normal variant.. Human genetics, [PMID:2394452] |
14. Graham, A A and 5 more authors.. (1989) Molecular characterisation of three alpha-1-antitrypsin deficiency variants: proteinase inhibitor (Pi) nullcardiff (Asp256----Val); PiMmalton (Phe51----deletion) and PiI (Arg39----Cys).. Human genetics, [PMID:2606478] |
15. and Kalsheker, N N.. (1989) Alpha 1-antitrypsin: structure, function and molecular biology of the gene.. Bioscience reports, [PMID:2669992] |
16. Hofker, M H MH and 7 more authors.. (1989) A Pro----Leu substitution in codon 369 of the alpha-1-antitrypsin deficiency variant PI MHeerlen.. Human genetics, [PMID:2784123] |
17. Engh, R R and 5 more authors.. (1989) The S variant of human alpha 1-antitrypsin, structure and implications for function and metabolism.. Protein engineering, [PMID:2785270] |
18. Fraizer, G C GC, Harrold, T R TR, Hofker, M H MH and Cox, D W DW.. (1989) In-frame single codon deletion in the Mmalton deficiency allele of alpha 1-antitrypsin.. American journal of human genetics, [PMID:2786335] |
19. Nukiwa, T T, Brantly, M L ML, Ogushi, F F, Fells, G A GA and Crystal, R G RG.. (1988) Characterization of the gene and protein of the common alpha 1-antitrypsin normal M2 allele.. American journal of human genetics, [PMID:2901226] |
20. Ciliberto, G G, Dente, L L and Cortese, R R.. (1985) Cell-specific expression of a transfected human alpha 1-antitrypsin gene.. Cell, [PMID:2985281] |
21. Takahashi, H H and 8 more authors.. (1988) Characterization of the gene and protein of the alpha 1-antitrypsin "deficiency" allele Mprocida.. The Journal of biological chemistry, (25): [PMID:3262617] |
22. Nukiwa, T T and 6 more authors.. (1986) Identification of a second mutation in the protein-coding sequence of the Z type alpha 1-antitrypsin gene.. The Journal of biological chemistry, (5): [PMID:3491072] |
23. Coutelle, C C and 5 more authors.. (1985) Construction and partial characterization of a human liver cDNA library.. Biomedica biochimica acta, [PMID:3873938] |
24. Riley, J H JH, Bathurst, I C IC, Edbrooke, M R MR, Carrell, R W RW and Craig, R K RK.. (1985) Alpha 1-antitrypsin and serum albumin mRNA accumulation in normal, acute phase and ZZ human liver.. FEBS letters, (23): [PMID:3876243] |
25. Long, G L GL, Chandra, T T, Woo, S L SL, Davie, E W EW and Kurachi, K K.. (1984) Complete sequence of the cDNA for human alpha 1-antitrypsin and the gene for the S variant.. Biochemistry, (9): [PMID:6093867] |
26. Bollen, A A and 8 more authors.. (1983) Cloning and expression in Escherichia coli of full-length complementary DNA coding for human alpha 1-antitrypsin.. DNA (Mary Ann Liebert, Inc.), [PMID:6319097] |
27. Loebermann, H H, Tokuoka, R R, Deisenhofer, J J and Huber, R R.. (1984) Human alpha 1-proteinase inhibitor. Crystal structure analysis of two crystal modifications, molecular model and preliminary analysis of the implications for function.. Journal of molecular biology, (15): [PMID:6332197] |
28. Rosenberg, S S, Barr, P J PJ, Najarian, R C RC and Hallewell, R A RA.. (1984) Synthesis in yeast of a functional oxidation-resistant mutant of human alpha-antitrypsin.. Nature, [PMID:6387509] |
29. Owen, M C MC, Brennan, S O SO, Lewis, J H JH and Carrell, R W RW.. (1983) Mutation of antitrypsin to antithrombin. alpha 1-antitrypsin Pittsburgh (358 Met leads to Arg), a fatal bleeding disorder.. The New England journal of medicine, (22): [PMID:6604220] |
30. Leicht, M M and 7 more authors.. (1982) Sequence homology and structural comparison between the chromosomal human alpha 1-antitrypsin and chicken ovalbumin genes.. Nature, (24): [PMID:6979715] |
31. Kurachi, K K and 6 more authors.. (1981) Cloning and sequence of cDNA coding for alpha 1-antitrypsin.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:7031661] |
32. Carrell, R W RW and 6 more authors.. (1982) Structure and variation of human alpha 1-antitrypsin.. Nature, (22): [PMID:7045697] |
33. Faber, J P JP and 6 more authors.. (1994) Identification and DNA sequence analysis of 15 new alpha 1-antitrypsin variants, including two PI*Q0 alleles and one deficient PI*M allele.. American journal of human genetics, [PMID:7977369] |
34. Hildesheim, J J, Kinsley, G G, Bissell, M M, Pierce, J J and Brantly, M M.. (1993) Genetic diversity from a limited repertoire of mutations on different common allelic backgrounds: alpha 1-antitrypsin deficiency variant Pduarte.. Human mutation, [PMID:8364590] |
35. Song, H K HK, Lee, K N KN, Kwon, K S KS, Yu, M H MH and Suh, S W SW.. (1995) Crystal structure of an uncleaved alpha 1-antitrypsin reveals the conformation of its inhibitory reactive loop.. FEBS letters, (18): [PMID:8543039] |
36. Elliott, P R PR, Lomas, D A DA, Carrell, R W RW and Abrahams, J P JP.. (1996) Inhibitory conformation of the reactive loop of alpha 1-antitrypsin.. Nature structural biology, [PMID:8756325] |
37. Ryu, S E SE, Choi, H J HJ, Kwon, K S KS, Lee, K N KN and Yu, M H MH.. (1996) The native strains in the hydrophobic core and flexible reactive loop of a serine protease inhibitor: crystal structure of an uncleaved alpha1-antitrypsin at 2.7 A.. Structure (London, England : 1993), (15): [PMID:8939743] |
38. Lovegrove, J U JU and 5 more authors.. (1997) A new alpha 1-antitrypsin mutation, Thr-Met 85, (PI Zbristol) associated with novel electrophoretic properties.. Annals of human genetics, [PMID:9459000] |
39. Elliott, P R PR, Abrahams, J P JP and Lomas, D A DA.. (1998) Wild-type alpha 1-antitrypsin is in the canonical inhibitory conformation.. Journal of molecular biology, (23): [PMID:9466920] |
40. Seixas, S S, Garcia, O O, Amorim, A A and Rocha, J J.. (2000) A novel alpha-1-antitrypsin r281del variant found in a population sample from the Basque country.. Human mutation, [PMID:10612848] |
41. Jardi, R R and 7 more authors.. (1998) Identification and molecular characterization of the new alpha-1-antitrypsin deficient allele PI Y barcelona (Asp256-->Val and Pro391-->His). Mutations in brief no. 174. Online.. Human mutation, [PMID:10651487] |
42. Dunstone, M A MA and 8 more authors.. (2000) Cleaved antitrypsin polymers at atomic resolution.. Protein science : a publication of the Protein Society, [PMID:10716194] |
43. Elliott, P R PR, Pei, X Y XY, Dafforn, T R TR and Lomas, D A DA.. (2000) Topography of a 2.0 A structure of alpha1-antitrypsin reveals targets for rational drug design to prevent conformational disease.. Protein science : a publication of the Protein Society, [PMID:10933492] |
44. Huntington, J A JA, Read, R J RJ and Carrell, R W RW.. (2000) Structure of a serpin-protease complex shows inhibition by deformation.. Nature, (19): [PMID:11057674] |
45. Kim, S S, Woo, J J, Seo, E J EJ, Yu, M M and Ryu, S S.. (2001) A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.. Journal of molecular biology, (9): [PMID:11178897] |
46. Im, Hana H, Woo, Mi-Sook MS, Hwang, Kwang Yeon KY and Yu, Myeong-Hee MH.. (2002) Interactions causing the kinetic trap in serpin protein folding.. The Journal of biological chemistry, (29): [PMID:12244055] |
47. Zhang, Hui H, Li, Xiao-Jun XJ, Martin, Daniel B DB and Aebersold, Ruedi R.. (2003) Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.. Nature biotechnology, [PMID:12754519] |
48. Dementiev, Alexey A, Simonovic, Miljan M, Volz, Karl K and Gettins, Peter G W PG.. (2003) Canonical inhibitor-like interactions explain reactivity of alpha1-proteinase inhibitor Pittsburgh and antithrombin with proteinases.. The Journal of biological chemistry, (26): [PMID:12860985] |
49. Bunkenborg, Jakob J, Pilch, Bartosz J BJ, Podtelejnikov, Alexandre V AV and Wiśniewski, Jacek R JR.. (2004) Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics, [PMID:14760718] |
50. Kristiansen, Troels Zakarias TZ and 8 more authors.. (2004) A proteomic analysis of human bile.. Molecular & cellular proteomics : MCP, [PMID:15084671] |
51. Lewandrowski, Urs U, Moebius, Jan J, Walter, Ulrich U and Sickmann, Albert A.. (2006) Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.. Molecular & cellular proteomics : MCP, [PMID:16263699] |
52. Liu, Tao T and 6 more authors.. () Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.. Journal of proteome research, [PMID:16335952] |
53. Kolarich, Daniel D, Weber, Alfred A, Turecek, Peter L PL, Schwarz, Hans-Peter HP and Altmann, Friedrich F.. (2006) Comprehensive glyco-proteomic analysis of human alpha1-antitrypsin and its charge isoforms.. Proteomics, [PMID:16622833] |
54. Shasany, Ajit K AK and 6 more authors.. (2007) An alpha-1 antitrypsin genetic variant from India.. Indian journal of biochemistry & biophysics, [PMID:17650587] |
55. Marques, Patrícia Isabel PI and 8 more authors.. (2013) SERPINA2 is a novel gene with a divergent function from SERPINA1.. PloS one, [PMID:23826168] |
56. Tagliabracci, Vincent S VS and 14 more authors.. (2015) A Single Kinase Generates the Majority of the Secreted Phosphoproteome.. Cell, (18): [PMID:26091039] |
57. Sheffield, William P WP and Bhakta, Varsha V.. (2016) The M358R variant of α(1)-proteinase inhibitor inhibits coagulation factor VIIa.. Biochemical and biophysical research communications, (12): [PMID:26797521] |
58. Esteghamat, Fatemehsadat F and 24 more authors.. (2019) CELA2A mutations predispose to early-onset atherosclerosis and metabolic syndrome and affect plasma insulin and platelet activation.. Nature genetics, [PMID:31358993] |