| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp167082-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp167082-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $469.90 | |
| rp167082-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $759.90 | |
| rp167082-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 30-371 aa
| Product Name | Recombinant Human SIRP beta 1/CD172b Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD172 antigen like family member B; CD172b; CD172b antigen; DKFZp686A05192; Signal regulatory protein beta 1; SIRP BETA 1; SIRP beta 1 isoform 3; SIRPB1; SIRP-BETA-1 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | When Recombinant Human SIRP beta 1/CD172b is immobilized at 1 µg/mL (100 µL/well), Recombinant Human SP‑D binds with an ED50 of 0.1-0.8 μg/mL |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 30-371 aa |
| Sequence | EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHFPRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAVRATPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLTRGDVHSQVICEIAHITLQGDPLRGTANLSEAIRVPPTLEVTQQPMRAENQANVTCQVSNFYPRGLQL |
| Protein Tag | C-His |
| Predicted molecular weight | 38 kDa |
| SDS-PAGE | 55-60 kDa, under reducing conditions |
Recombinant Human SIRP beta 1/CD172b Protein (rp167082) - Protein Bioactivity
When Recombinant Human SIRP beta 1/CD172b Protein (rp167082) is immobilized at 1.0 µg/mL, Recombinant Human SP‑D binds with an ED₅₀ of 0.93 μg/mL.
Recombinant Human SIRP beta 1/CD172b Protein (rp167082) - SDS-PAGE
3 μg/lane of Recombinant Human SIRP beta 1/CD172b Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 45.0 - 55.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404855 | Certificate of Analysis | Apr 26, 2024 | rp167082 |
| ZJ24F0404854 | Certificate of Analysis | Apr 26, 2024 | rp167082 |
| ZJ24F0404853 | Certificate of Analysis | Apr 26, 2024 | rp167082 |
