| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp151779-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $79.90 | |
| rp151779-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $199.90 | |
| rp151779-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $379.90 | |
| rp151779-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,799.90 |
Animal Free, >98% (SDS-PAGE, HPLC), Active, E.coli, No tag, 18-303 aa
| Product Name | Recombinant Human SPARC Protein, ＞98% (SDS-PAGE, HPLC), high purity |
|---|---|
| Synonyms | ON; ONT; OI17; BM-40; Basement-membrane protein 40; ONcysteine-rich protein; Osteonectin; Secreted protein acidic and rich in cysteine; secreted protein, acidic, cysteine-rich (osteonectin); SPARC; AA517111; Basement membrane protein 40; Basement-membrane |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | ＞98% (SDS-PAGE, HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 18-303 aa |
| Sequence | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFET |
| Protein Tag | No tag |
| Accession # | P09486 |
| Predicted molecular weight | 32.7 kDa |
| SDS-PAGE | 32.7 kDa |
Recombinant Human SPARC Protein (rp151779)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.
Recombinant Human SPARC Protein (rp151779) - SDS-PAGE
Recombinant Human SPARC Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining. Showing a single band at 32.7 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconsti |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600329 | Certificate of Analysis | Mar 26, 2024 | rp151779 |
| ZJ23F0600330 | Certificate of Analysis | Mar 26, 2024 | rp151779 |
| ZJ23F0600331 | Certificate of Analysis | Mar 26, 2024 | rp151779 |
| 1. Kelm, R J RJ and Mann, K G KG.. (1990) Human platelet osteonectin: release, surface expression, and partial characterization.. Blood, (1): [PMID:2306517] |
| 2. Young, M F MF and 5 more authors.. (1990) Structure and expression of osteonectin mRNA in human tissue.. Connective tissue research, [PMID:2338025] |
| 3. Villarreal, X C XC, Mann, K G KG and Long, G L GL.. (1989) Structure of human osteonectin based upon analysis of cDNA and genomic sequences.. Biochemistry, (25): [PMID:2790009] |
| 4. Swaroop, A A, Hogan, B L BL and Francke, U U.. (1988) Molecular analysis of the cDNA for human SPARC/osteonectin/BM-40: sequence, expression, and localization of the gene to chromosome 5q31-q33.. Genomics, [PMID:2838412] |
| 5. Wewer, U M UM, Albrechtsen, R R, Fisher, L W LW, Young, M F MF and Termine, J D JD.. (1988) Osteonectin/SPARC/BM-40 in human decidua and carcinoma, tissues characterized by de novo formation of basement membrane.. The American journal of pathology, [PMID:3400777] |
| 6. Lankat-Buttgereit, B B, Mann, K K, Deutzmann, R R, Timpl, R R and Krieg, T T.. (1988) Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin).. FEBS letters, (29): [PMID:3410046] |
| 7. Fisher, L W LW, Hawkins, G R GR, Tuross, N N and Termine, J D JD.. (1987) Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone.. The Journal of biological chemistry, (15): [PMID:3597437] |
| 8. Kuhn, C C and Mason, R J RJ.. (1995) Immunolocalization of SPARC, tenascin, and thrombospondin in pulmonary fibrosis.. The American journal of pathology, [PMID:7495300] |
| 9. Hohenester, E E and 5 more authors.. (1996) Structure of a novel extracellular Ca(2+)-binding module in BM-40.. Nature structural biology, [PMID:8548457] |
| 10. Hohenester, E E, Maurer, P P and Timpl, R R.. (1997) Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.. The EMBO journal, (1): [PMID:9233787] |
| 11. Hunzelmann, N N, Hafner, M M, Anders, S S, Krieg, T T and Nischt, R R.. (1998) BM-40 (osteonectin, SPARC) is expressed both in the epidermal and in the dermal compartment of adult human skin.. The Journal of investigative dermatology, [PMID:9457905] |
| 12. Sasaki, T T, Hohenester, E E, Göhring, W W and Timpl, R R.. (1998) Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.. The EMBO journal, (16): [PMID:9501084] |
| 13. Bechtel, Stephanie S and 18 more authors.. (2007) The full-ORF clone resource of the German cDNA Consortium.. BMC genomics, (31): [PMID:17974005] |
| 14. Mendoza-Londono, Roberto R and 20 more authors.. (2015) Recessive osteogenesis imperfecta caused by missense mutations in SPARC.. American journal of human genetics, (4): [PMID:26027498] |
