Skip to the beginning of the images gallery

Recombinant Human SPARC Protein, ＞98% (SDS-PAGE, HPLC), high purity

≥98%(SDS-PAGE&HPLC)

Features and benefits

Expression System: E.coli
Accession #: P09486
Protein Tag: No tag
Bioactivity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp151779

Grouped product items
SKU	Size	Availability	Price
rp151779-10μg	10μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$79.90
rp151779-50μg	50μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$199.90
rp151779-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$379.90
rp151779-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,799.90

Animal Free, >98% (SDS-PAGE, HPLC), Active, E.coli, No tag, 18-303 aa

View related series

Click to view protein information: SPARC

Accession#:P09486 Gene ID:6678 SPARC

Basic Description

Product Name	Recombinant Human SPARC Protein, ＞98% (SDS-PAGE, HPLC), high purity
Synonyms	ON; ONT; OI17; BM-40; Basement-membrane protein 40; ONcysteine-rich protein; Osteonectin; Secreted protein acidic and rich in cysteine; secreted protein, acidic, cysteine-rich (osteonectin); SPARC; AA517111; Basement membrane protein 40; Basement-membrane
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity >98% by SDS-PAGE and HPLC analyses. Function Appears to regulate cell growth through interactions with the extracellular matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell membranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca (2+) with a low affinity and an EF-hand loop that binds a Ca(2+) ion with a high affinity.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC)
Purity	＞98% (SDS-PAGE, HPLC)
Bioactivity	Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	E.coli
Species	Human
Amino Acids	18-303 aa
Sequence	APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFET
Protein Tag	No tag
Accession #	P09486
Predicted molecular weight	32.7 kDa
SDS-PAGE	32.7 kDa

Images

Recombinant Human SPARC Protein (rp151779)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 μg/mL, corresponding to a specific activity of > 333 IU/mg.

Recombinant Human SPARC Protein (rp151779) - SDS-PAGE
Recombinant Human SPARC Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining. Showing a single band at 32.7 kDa.

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconsti

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0600329	Certificate of Analysis	Mar 26, 2024	rp151779
ZJ23F0600330	Certificate of Analysis	Mar 26, 2024	rp151779
ZJ23F0600331	Certificate of Analysis	Mar 26, 2024	rp151779

References

1. Kelm, R J RJ and Mann, K G KG.. (1990) Human platelet osteonectin: release, surface expression, and partial characterization.. Blood, (1): [PMID:2306517]
2. Young, M F MF and 5 more authors.. (1990) Structure and expression of osteonectin mRNA in human tissue.. Connective tissue research, [PMID:2338025]
3. Villarreal, X C XC, Mann, K G KG and Long, G L GL.. (1989) Structure of human osteonectin based upon analysis of cDNA and genomic sequences.. Biochemistry, (25): [PMID:2790009]
4. Swaroop, A A, Hogan, B L BL and Francke, U U.. (1988) Molecular analysis of the cDNA for human SPARC/osteonectin/BM-40: sequence, expression, and localization of the gene to chromosome 5q31-q33.. Genomics, [PMID:2838412]
5. Wewer, U M UM, Albrechtsen, R R, Fisher, L W LW, Young, M F MF and Termine, J D JD.. (1988) Osteonectin/SPARC/BM-40 in human decidua and carcinoma, tissues characterized by de novo formation of basement membrane.. The American journal of pathology, [PMID:3400777]
6. Lankat-Buttgereit, B B, Mann, K K, Deutzmann, R R, Timpl, R R and Krieg, T T.. (1988) Cloning and complete amino acid sequences of human and murine basement membrane protein BM-40 (SPARC, osteonectin).. FEBS letters, (29): [PMID:3410046]
7. Fisher, L W LW, Hawkins, G R GR, Tuross, N N and Termine, J D JD.. (1987) Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone.. The Journal of biological chemistry, (15): [PMID:3597437]
8. Kuhn, C C and Mason, R J RJ.. (1995) Immunolocalization of SPARC, tenascin, and thrombospondin in pulmonary fibrosis.. The American journal of pathology, [PMID:7495300]
9. Hohenester, E E and 5 more authors.. (1996) Structure of a novel extracellular Ca(2+)-binding module in BM-40.. Nature structural biology, [PMID:8548457]
10. Hohenester, E E, Maurer, P P and Timpl, R R.. (1997) Crystal structure of a pair of follistatin-like and EF-hand calcium-binding domains in BM-40.. The EMBO journal, (1): [PMID:9233787]
11. Hunzelmann, N N, Hafner, M M, Anders, S S, Krieg, T T and Nischt, R R.. (1998) BM-40 (osteonectin, SPARC) is expressed both in the epidermal and in the dermal compartment of adult human skin.. The Journal of investigative dermatology, [PMID:9457905]
12. Sasaki, T T, Hohenester, E E, Göhring, W W and Timpl, R R.. (1998) Crystal structure and mapping by site-directed mutagenesis of the collagen-binding epitope of an activated form of BM-40/SPARC/osteonectin.. The EMBO journal, (16): [PMID:9501084]
13. Bechtel, Stephanie S and 18 more authors.. (2007) The full-ORF clone resource of the German cDNA Consortium.. BMC genomics, (31): [PMID:17974005]
14. Mendoza-Londono, Roberto R and 20 more authors.. (2015) Recessive osteogenesis imperfecta caused by missense mutations in SPARC.. American journal of human genetics, (4): [PMID:26027498]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.