| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp152319-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp152319-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $489.90 | |
| rp152319-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $779.90 | |
| rp152319-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,999.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, His tag, 1-515 aa
| Product Name | Recombinant Human Thrombomodulin/BDCA-3 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | BDCA3; BDCA-3; CD141 antigen; CD141; Fetomodulin; THBD; THRM; Thrombomodulin; TM; AHUS6; THPH12 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity >95% SDS-PAGE. Function Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C (protein Ca). Once evolved, protein Ca scissions the activated cofactors of the coagulation mechanism, factor Va and factor VIIIa, and thereby reduces the amount of thrombin generated. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | Measured by its ability to activate protein C induced cleavage of the chromogenic substrate, BOC-Asp-Pro Arg-AMC in the presence of thrombin. The specific activity is greater than 500 pmoles/min/ug. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 1-515 aa |
| Sequence | MLGVLVLGALALAGLGFPAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHA |
| Protein Tag | C-His |
| Accession # | P07204 |
| Predicted molecular weight | 51 kDa |
| SDS-PAGE | 77.9 kDa, under reducing conditions; 71.6 kDa, under non-reducing conditions. |
Recombinant Human Thrombomodulin/BDCA-3 Protein - SDS-PAGE
3 μg/lane of Recombinant Human Thrombomodulin/BDCA-3 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 77.9 kDa under reducing conditions and 71.6 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505760 | Certificate of Analysis | May 24, 2024 | rp152319 |
| ZJ24F0505759 | Certificate of Analysis | May 24, 2024 | rp152319 |
| ZJ24F0505758 | Certificate of Analysis | May 24, 2024 | rp152319 |
| 1. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J. (2001) The DNA sequence and comparative analysis of human chromosome 20.. Nature, 414 (6866): (865-71). [PMID:11780052] |
| 2. McCachren, S S SS, Diggs, J J, Weinberg, J B JB and Dittman, W A WA.. (1991) Thrombomodulin expression by human blood monocytes and by human synovial tissue lining macrophages.. Blood, (15): [PMID:1660324] |
| 3. Jackman, R W RW, Beeler, D L DL, Fritze, L L, Soff, G G and Rosenberg, R D RD.. (1987) Human thrombomodulin gene is intron depleted: nucleic acid sequences of the cDNA and gene predict protein structure and suggest sites of regulatory control.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2819876] |
| 4. Suzuki, K K and 9 more authors.. (1987) Structure and expression of human thrombomodulin, a thrombin receptor on endothelium acting as a cofactor for protein C activation.. The EMBO journal, [PMID:2820710] |
| 5. Wen, D Z DZ and 5 more authors.. (1987) Human thrombomodulin: complete cDNA sequence and chromosome localization of the gene.. Biochemistry, (14): [PMID:2822087] |
| 6. Shirai, T T and 7 more authors.. (1988) Gene structure of human thrombomodulin, a cofactor for thrombin-catalyzed activation of protein C.. Journal of biochemistry, [PMID:2836377] |
| 7. Adler, M M and 5 more authors.. (1995) The structure of a 19-residue fragment from the C-loop of the fourth epidermal growth factor-like domain of thrombomodulin.. The Journal of biological chemistry, (6): [PMID:7559494] |
| 8. Ohlin, A K AK and Marlar, R A RA.. (1995) The first mutation identified in the thrombomodulin gene in a 45-year-old man presenting with thromboembolic disease.. Blood, (15): [PMID:7811989] |
| 9. Srinivasan, J J and 5 more authors.. (1994) Thrombin-bound structure of an EGF subdomain from human thrombomodulin determined by transferred nuclear Overhauser effects.. Biochemistry, (22): [PMID:7947766] |
| 10. Gerlitz, B B and 5 more authors.. (1993) Identification of the predominant glycosaminoglycan-attachment site in soluble recombinant human thrombomodulin: potential regulation of functionality by glycosyltransferase competition for serine474.. The Biochemical journal, (1): [PMID:8216207] |
| 11. Yamamoto, S S and 5 more authors.. (1993) Urinary thrombomodulin, its isolation and characterization.. Journal of biochemistry, [PMID:8390446] |
| 12. Meininger, D P DP, Hunter, M J MJ and Komives, E A EA.. (1995) Synthesis, activity, and preliminary structure of the fourth EGF-like domain of thrombomodulin.. Protein science : a publication of the Protein Society, [PMID:8528067] |
| 13. Hrabal, R R, Komives, E A EA and Ni, F F.. (1996) Structural resiliency of an EGF-like subdomain bound to its target protein, thrombin.. Protein science : a publication of the Protein Society, [PMID:8745396] |
| 14. Norlund, L L, Holm, J J, Zöller, B B and Ohlin, A K AK.. (1997) A common thrombomodulin amino acid dimorphism is associated with myocardial infarction.. Thrombosis and haemostasis, [PMID:9157575] |
| 15. Ohlin, A K AK, Norlund, L L and Marlar, R A RA.. (1997) Thrombomodulin gene variations and thromboembolic disease.. Thrombosis and haemostasis, [PMID:9198186] |
| 16. Sampoli Benitez, B A BA, Hunter, M J MJ, Meininger, D P DP and Komives, E A EA.. (1997) Structure of the fifth EGF-like domain of thrombomodulin: An EGF-like domain with a novel disulfide-bonding pattern.. Journal of molecular biology, (7): [PMID:9367781] |
| 17. Doggen, C J CJ and 7 more authors.. (1998) A mutation in the thrombomodulin gene, 127G to A coding for Ala25Thr, and the risk of myocardial infarction in men.. Thrombosis and haemostasis, [PMID:9843165] |
| 18. Wu, K K KK and 6 more authors.. (2001) Thrombomodulin Ala455Val polymorphism and risk of coronary heart disease.. Circulation, (13): [PMID:11245641] |
| 19. Gresele, Paolo P and Agnelli, Giancarlo G.. (2002) Novel approaches to the treatment of thrombosis.. Trends in pharmacological sciences, [PMID:11804648] |
| 20. Faioni, Elena M EM, Franchi, Franca F, Castaman, Giancarlo G, Biguzzi, Eugenia E and Rodeghiero, Francesco F.. (2002) Mutations in the thrombomodulin gene are rare in patients with severe thrombophilia.. British journal of haematology, [PMID:12139752] |
| 21. Delvaeye, Mieke M and 12 more authors.. (2009) Thrombomodulin mutations in atypical hemolytic-uremic syndrome.. The New England journal of medicine, (23): [PMID:19625716] |
| 22. Maga, Tara K TK, Nishimura, Carla J CJ, Weaver, Amy E AE, Frees, Kathy L KL and Smith, Richard J H RJ.. (2010) Mutations in alternative pathway complement proteins in American patients with atypical hemolytic uremic syndrome.. Human mutation, [PMID:20513133] |
| 23. Palayoor, Sanjeewani T and 6 more authors.. (2012) Gene expression profile of coronary artery cells treated with nonsteroidal anti-inflammatory drugs reveals off-target effects.. Journal of cardiovascular pharmacology, [PMID:22668799] |
| 24. Kawamoto, Eiji E and 6 more authors.. (2016) LFA-1 and Mac-1 integrins bind to the serine/threonine-rich domain of thrombomodulin.. Biochemical and biophysical research communications, (13): [PMID:27055590] |
