| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp152321-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp152321-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $499.90 | |
| rp152321-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $799.90 | |
| rp152321-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,399.90 |
Animal Free, >95% SDS-PAGE, Active, HEK 293F, His tag, 22-353 aa
| Product Name | Recombinant Human Thrombopoietin Protein, ＞95% SDS-PAGE, high purity |
|---|---|
| Synonyms | Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; megakaryocyte stimulating factor; MGDF; MGDFC-mpl ligand; MKCSF; MK-CSF; ML; MPL ligand; MPLLG; MPLLGMGC163194; Myeloproliferative leukemia virus oncogene ligand; THCYT1 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >95% SDS-PAGE. Additional sequence information Full length mature chain without signal peptide. Function Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95% SDS-PAGE |
| Bioactivity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is typically less than 50 ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 22-353 aa |
| Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISS |
| Protein Tag | C-His |
| Accession # | P40225 |
| Predicted molecular weight | 37 kDa |
| SDS-PAGE | 70-90 kDa, under reducing conditions; 70-90 kDa, under non-reducing conditions. |
Recombinant Human Thrombopoietin Protein (rp152321) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically less than 50 ng/mL.
Recombinant Human Thrombopoietin Protein (rp152321) - SDS-PAGE
2.5 μg/lane of Recombinant Human Thrombopoietin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 70-90 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to 0.1mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolong |
| Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -80°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0700633 | Certificate of Analysis | Jul 21, 2023 | rp152321 |
| ZJ23F0700632 | Certificate of Analysis | Jul 20, 2023 | rp152321 |
| ZJ23F0700631 | Certificate of Analysis | Jul 20, 2023 | rp152321 |
| 1. Foster, D C DC and 9 more authors.. (1994) Human thrombopoietin: gene structure, cDNA sequence, expression, and chromosomal localization.. Proceedings of the National Academy of Sciences of the United States of America, (20): [PMID:7809166] |
| 2. Chang, M S MS and 9 more authors.. (1995) Cloning and characterization of the human megakaryocyte growth and development factor (MGDF) gene.. The Journal of biological chemistry, (13): [PMID:7822271] |
| 3. Gurney, A L AL and 5 more authors.. (1995) Genomic structure, chromosomal localization, and conserved alternative splice forms of thrombopoietin.. Blood, (15): [PMID:7849319] |
| 4. Sohma, Y Y and 8 more authors.. (1994) Molecular cloning and chromosomal localization of the human thrombopoietin gene.. FEBS letters, (10): [PMID:7926023] |
| 5. Bartley, T D TD and 9 more authors.. (1994) Identification and cloning of a megakaryocyte growth and development factor that is a ligand for the cytokine receptor Mpl.. Cell, (1): [PMID:8020099] |
| 6. de Sauvage, F J FJ and 9 more authors.. (1994) Stimulation of megakaryocytopoiesis and thrombopoiesis by the c-Mpl ligand.. Nature, (16): [PMID:8202154] |
| 7. Kato, T T and 9 more authors.. (1995) Purification and characterization of thrombopoietin.. Journal of biochemistry, [PMID:8537317] |
| 8. Hoffman, R C RC and 6 more authors.. (1996) Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246.. Biochemistry, (26): [PMID:8942648] |
| 9. Wiestner, A A, Schlemper, R J RJ, van der Maas, A P AP and Skoda, R C RC.. (1998) An activating splice donor mutation in the thrombopoietin gene causes hereditary thrombocythaemia.. Nature genetics, [PMID:9425899] |
| 10. Feese, Michael D MD and 14 more authors.. (2004) Structure of the receptor-binding domain of human thrombopoietin determined by complexation with a neutralizing antibody fragment.. Proceedings of the National Academy of Sciences of the United States of America, (17): [PMID:14769915] |
