Recombinant Human Tie-2 Protein

Item Number

rp179792

• Product Name: Recombinant Human Tie-2 Protein
• Grade: Animal Free, Carrier Free
• Specifications & Purity: Animal Free, Carrier Free, ≥95%(SDS-PAGE)
• Bioactivity: Testing in progress
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-745 aa
• Sequence: MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWRPHEPITIGRDFEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQQASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPHAQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNHLCTACMNNGVCHEDTGECICPPGFMGRTCEKAC
• Protein Tag: C-His
• Predicted molecular weight: 81.4 kDa
• SDS-PAGE: 101.3 kDa, under reducing conditions; 99.4 kDa, under non-reducing conditions

Product Description

Protein Function:
Tie-1/Tie (tyrosine kinase with Ig and EGF homology domains 1) and Tie-2/Tek comprise a receptor tyrosine kinase (RTK) subfamily with unique structural characteristics: two immunoglobulin-like domains flanking three epidermal growth factor (EGF)-like domains and followed by three fibronectin type III-like repeats in the extracellular region and a split tyrosine kinase domain in the cytoplasmic region. These receptors are expressed primarily on endothelial and hematopoietic progenitor cells and play critical roles in angiogenesis, vasculogenesis and hematopoiesis. Human Tie-2 cDNA encodes a 1124 amino acid (aa) precursor protein with an 18 aa putative signal peptide, a 727 aa extracellular domain (ECD) and a 354 aa cytoplasmic domain. Human Tie-2 ECD shares 90% aa identity with mouse and rat Tie-2. Two ligands, angiopoietin1 (Ang1) and angiopoietin2 (Ang2), which bind Tie-2 with high affinity, have been identified. Ang2 has been reported to act as an antagonist for Ang1. Mice engineered to over-express Ang2 or to lack Ang1 or Tie-2 display similar angiogenesis defects.