| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp152424-5μg | 5μg | In stock | $99.90 | |
| rp152424-20μg | 20μg | In stock | $279.90 | |
| rp152424-100μg | 100μg | In stock | $899.90 | |
| rp152424-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,559.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F, His-tag; 34-251 aa
| Product Name | Recombinant Human Tissue Factor Protein, ＞95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD142 antigen; CD142; coagulation factor III (thromboplastin, tissue factor); Coagulation Factor III; F3; FLJ17960; TF; TFA; Thromboplastin; Tissue Factor |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity
|
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Bioactivity | Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC50 is <24.0 μg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 34-251 aa |
| Sequence | GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREHHHHHH |
| Protein Tag | C-His |
| Accession # | P13726 |
| Predicted molecular weight | 37-45 kDa |
| SDS-PAGE | 37-45 kDa |
Recombinant Human Tissue Factor Protein (rp152424) - Protein Bioactivity
Measured by its ability to activate Coagulation Factor VII in cleaving a fluorogenic peptide substrate Boc-VPR-AMC. The AC₅₀ is < 24.0 μg/mL.
Recombinant Human Tissue Factor Protein (rp152424) - SDS-PAGE
2.5 μg/lane of Recombinant Human Tissue Factor was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 37.0 - 45.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | -80℃~ -20℃ for 12 months，aviod freeze and thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101632 | Certificate of Analysis | Nov 27, 2023 | rp152424 |
| ZJ23F1101633 | Certificate of Analysis | Nov 27, 2023 | rp152424 |
| ZJ23F1101634 | Certificate of Analysis | Nov 27, 2023 | rp152424 |
| 1. Breij EC, de Goeij BE, Verploegen S, Schuurhuis DH, Amirkhosravi A, Francis J, Miller VB, Houtkamp M, Bleeker WK, Satijn D et al.. (2014) An antibody-drug conjugate that targets tissue factor exhibits potent therapeutic activity against a broad range of solid tumors.. Cancer Res, 74 (4): (1214-26). [PMID:24371232] |
| 2. Thomas R Burkard,Melanie Planyavsky,Ines Kaupe,Florian P Breitwieser,Tilmann Bürckstümmer,Keiryn L Bennett,Giulio Superti-Furga,Jacques Colinge. (2011-01-29) Initial characterization of the human central proteome.. BMC systems biology, 5 (17-17). [PMID:21269460] |
| 3. Jianguo Wang,Shawn A Mahmud,Peter B Bitterman,Yuqing Huo,Arne Slungaard. (2007-08-07) Histone deacetylase inhibitors suppress TF-kappaB-dependent agonist-driven tissue factor expression in endothelial cells and monocytes.. The Journal of biological chemistry, 282 ((39)): (28408-28418). [PMID:17675290] |
| 4. Choi-Sledeski YM, McGarry DG, Green DM, Mason HJ, Becker MR, Davis RS, Ewing WR, Dankulich WP, Manetta VE, Morris RL, Spada AP, Cheney DL, Brown KD, Colussi DJ, Chu V, Heran CL, Morgan SR, Bentley RG, Leadley RJ, Maignan S, Guilloteau JP, Dunwiddie CT, Pauls HW.. (1999) Sulfonamidopyrrolidinone factor Xa inhibitors: potency and selectivity enhancements via P-1 and P-4 optimization.. J Med Chem, 42 (18): (3572-3587). [PMID:10479289] |
| 5. Parlow JJ, Case BL, Dice TA, Fenton RL, Hayes MJ, Jones DE, Neumann WL, Wood RS, Lachance RM, Girard TJ, Nicholson NS, Clare M, Stegeman RA, Stevens AM, Stallings WC, Kurumbail RG, South MS.. (2003) Design, parallel synthesis, and crystal structures of pyrazinone antithrombotics as selective inhibitors of the tissue factor VIIa complex.. J Med Chem, 46 (19): (4050-4062). [PMID:12954058] |
| 6. Young WB, Mordenti J, Torkelson S, Shrader WD, Kolesnikov A, Rai R, Liu L, Hu H, Leahy EM, Green MJ, Sprengeler PA, Katz BA, Yu C, Janc JW, Elrod KC, Marzec UM, Hanson SR.. (2006) Factor VIIa inhibitors: chemical optimization, preclinical pharmacokinetics, pharmacodynamics, and efficacy in an arterial baboon thrombosis model.. Bioorg Med Chem Lett, 16 (7): (2037-2041). [PMID:16412633] |
| 7. Steinmetzer T, Schweinitz A, Stürzebecher A, Dönnecke D, Uhland K, Schuster O, Steinmetzer P, Müller F, Friedrich R, Than ME, Bode W, Stürzebecher J.. (2006) Secondary amides of sulfonylated 3-amidinophenylalanine. New potent and selective inhibitors of matriptase.. J Med Chem, 49 (14): (4116-4126). [PMID:16821772] |
| 8. Pinto DJ, Orwat MJ, Quan ML, Han Q, Galemmo RA, Amparo E, Wells B, Ellis C, He MY, Alexander RS, Rossi KA, Smallwood A, Wong PC, Luettgen JM, Rendina AR, Knabb RM, Mersinger L, Kettner C, Bai S, He K, Wexler RR, Lam PY.. (2006) 1-[3-Aminobenzisoxazol-5'-yl]-3-trifluoromethyl-6-[2'-(3-(R)-hydroxy-N-pyrrolidinyl)methyl-[1,1']-biphen-4-yl]-1,4,5,6-tetrahydropyrazolo-[3,4-c]-pyridin-7-one (BMS-740808) a highly potent, selective, efficacious, and orally bioavailable inhibitor of blood coagulation factor Xa.. Bioorg Med Chem Lett, 16 (15): (4141-4147). [PMID:16730984] |
| 9. Wang D, Girard TJ, Kasten TP, LaChance RM, Miller-Wideman MA, Durley RC.. (1998) Inhibitory activity of unsaturated fatty acids and anacardic acids toward soluble tissue factor-factor VIIa complex.. J Nat Prod, 61 (11): (1352-1355). [PMID:9834151] |
| 10. Kotian PL, Krishnan R, Rowland S, El-Kattan Y, Saini SK, Upshaw R, Bantia S, Arnold S, Babu YS, Chand P.. (2009) Design, parallel synthesis, and crystal structures of biphenyl antithrombotics as selective inhibitors of tissue factor FVIIa complex. Part 1: Exploration of S2 pocket pharmacophores.. Bioorg Med Chem, 17 (11): (3934-3958). [PMID:19409795] |
| 11. Zhang X, Glunz PW, Johnson JA, Jiang W, Jacutin-Porte S, Ladziata V, Zou Y, Phillips MS, Wurtz NR, Parkhurst B, Rendina AR, Harper TM, Cheney DL, Luettgen JM, Wong PC, Seiffert D, Wexler RR, Priestley ES.. (2016) Discovery of a Highly Potent, Selective, and Orally Bioavailable Macrocyclic Inhibitor of Blood Coagulation Factor VIIa-Tissue Factor Complex.. J Med Chem, 59 (15): (7125-7137). [PMID:27455395] |
| 12. Ladziata VU, Glunz PW, Zou Y, Zhang X, Jiang W, Jacutin-Porte S, Cheney DL, Wei A, Luettgen JM, Harper TM, Wong PC, Seiffert D, Wexler RR, Priestley ES.. (2016) Synthesis and P1' SAR exploration of potent macrocyclic tissue factor-factor VIIa inhibitors.. Bioorg Med Chem Lett, 26 (20): (5051-5057). [PMID:27612545] |
| 13. Fischer PM.. (2018) Design of Small-Molecule Active-Site Inhibitors of the S1A Family Proteases as Procoagulant and Anticoagulant Drugs.. J Med Chem, 61 (9): (3799-3822). [PMID:29072911] |
| 14. Rogers, K S KS, Barton, C L CL, Benson, P A PA and Green, R A RA.. (1992) Effects of single-dose L-asparaginase on coagulation values in healthy dogs and dogs with lymphoma.. American journal of veterinary research, [PMID:1586032] |
| 15. Mackman, N N, Morrissey, J H JH, Fowler, B B and Edgington, T S TS.. (1989) Complete sequence of the human tissue factor gene, a highly regulated cellular receptor that initiates the coagulation protease cascade.. Biochemistry, (21): [PMID:2719931] |
| 16. Scarpati, E M EM and 6 more authors.. (1987) Human tissue factor: cDNA sequence and chromosome localization of the gene.. Biochemistry, (25): [PMID:2823875] |
| 17. Spicer, E K EK and 9 more authors.. (1987) Isolation of cDNA clones coding for human tissue factor: primary structure of the protein and cDNA.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:3037536] |
| 18. Bach, R R, Konigsberg, W H WH and Nemerson, Y Y.. (1988) Human tissue factor contains thioester-linked palmitate and stearate on the cytoplasmic half-cystine.. Biochemistry, (14): [PMID:3166978] |
| 19. Morrissey, J H JH, Fakhrai, H H and Edgington, T S TS.. (1987) Molecular cloning of the cDNA for tissue factor, the cellular receptor for the initiation of the coagulation protease cascade.. Cell, (3): [PMID:3297348] |
| 20. Fisher, K L KL, Gorman, C M CM, Vehar, G A GA, O'Brien, D P DP and Lawn, R M RM.. (1987) Cloning and expression of human tissue factor cDNA.. Thrombosis research, (1): [PMID:3424286] |
| 21. Muller, Y A YA, Ultsch, M H MH, Kelley, R F RF and de Vos, A M AM.. (1994) Structure of the extracellular domain of human tissue factor: location of the factor VIIa binding site.. Biochemistry, (13): [PMID:8086403] |
| 22. Banner, D W DW and 7 more authors.. (1996) The crystal structure of the complex of blood coagulation factor VIIa with soluble tissue factor.. Nature, (7): [PMID:8598903] |
| 23. Muller, Y A YA, Ultsch, M H MH and de Vos, A M AM.. (1996) The crystal structure of the extracellular domain of human tissue factor refined to 1.7 A resolution.. Journal of molecular biology, (16): [PMID:8609606] |
| 24. Zhang, E E, St Charles, R R and Tulinsky, A A.. (1999) Structure of extracellular tissue factor complexed with factor VIIa inhibited with a BPTI mutant.. Journal of molecular biology, (5): [PMID:9925787] |
| 25. Bogdanov, Vladimir Y VY and 5 more authors.. (2003) Alternatively spliced human tissue factor: a circulating, soluble, thrombogenic protein.. Nature medicine, [PMID:12652293] |
| 26. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414] |
| 27. Eisenreich, Andreas A and 7 more authors.. (2009) Cdc2-like kinases and DNA topoisomerase I regulate alternative splicing of tissue factor in human endothelial cells.. Circulation research, (13): [PMID:19168442] |
| 28. Nadir, Yona Y and 5 more authors.. (2010) Heparanase enhances the generation of activated factor X in the presence of tissue factor and activated factor VII.. Haematologica, [PMID:20634491] |
| 29. Hong, David S and 20 more authors.. (2020) Tisotumab Vedotin in Previously Treated Recurrent or Metastatic Cervical Cancer.. Clinical cancer research : an official journal of the American Association for Cancer Research, (15): [PMID:31796521] |
