Recombinant Human TMIGD2/CD28H Protein, ≥95% (SDS-PAGE), high purity

Features and benefits

Expression System: HEK293
Accession #: Q96BF3
Protein Tag: C-His
Bioactivity: Immobilized Recombinant Human TMIGD2/CD28H Protein (rp152488) at 5.0 μg/mL can bind Human B7-H7 with the EC50 for this effect is 50.12 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

Item Number

rp152488

Grouped product items
SKU	Size	Availability	Price
rp152488-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$79.90
rp152488-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$209.90
rp152488-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$319.90
rp152488-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,599.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 23-150 aa

View related series

Basic Description

Product Name	Recombinant Human TMIGD2/CD28H Protein, ≥95% (SDS-PAGE), high purity
Synonyms	CD28 homolog \| IGPR-1 \| Immunoglobulin and proline-rich receptor 1 \| Transmembrane And Immunoglobulin Domain Containing 2 \| CD28H \| IGPR1 \| IGPR-1 \| MGC23244 \| TMIGD2 \| transmembrane and immunoglobulin domain-containing protein 2
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% SDS-PAGE. Endotoxin level <0.1 EU/µg
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	Immobilized Recombinant Human TMIGD2/CD28H Protein (rp152488) at 5.0 μg/mL can bind Human B7-H7 with the EC50 for this effect is 50.12 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	23-150 aa
Sequence	LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGHHHHHH
Protein Tag	C-His
Accession #	Q96BF3
Predicted molecular weight	15 kDa
SDS-PAGE	25 - 33 kDa, under reducing conditions; 25 - 33 & 45 - 60 kDa, under non-reducing conditions.

Form

Lyophilized

Reconstitution

Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.

Storage Temp

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid

References

1. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161]
2. Rahimi, Nader N, Rezazadeh, Kobra K, Mahoney, John E JE, Hartsough, Edward E and Meyer, Rosana D RD.. (2012) Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis.. Molecular biology of the cell, [PMID:22419821]
3. Zhu, Yuwen Y and 15 more authors.. (2013) B7-H5 costimulates human T cells via CD28H.. Nature communications, [PMID:23784006]

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description