Skip to the beginning of the images gallery

Recombinant Human TNF RII/TNFRSF1B Protein

ActiBioPure™
Animal Free
Bioactive
Carrier Free
高性能
≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Protein Tag: C-hFc
Bioactivity: Measured by its ability to inhibit TNF-α mediated cytotoxicity in L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D (A113142). The ED50 for this effect is typically 25.25 ng/mL in the presence of 1.0 ng/mL Recombinant
Endotoxin Concentration: <1 EU/μg

Item Number

rp179793

Grouped product items
SKU	Size	Availability	Price
rp179793-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$89.90
rp179793-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$299.90
rp179793-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$479.90
rp179793-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C- hIgG1Fc tag, 1-257 aa

View related series

Accession#:P20333 Gene ID:7133 TNFRSF1B

Basic Description

Product Name	Recombinant Human TNF RII/TNFRSF1B Protein
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, 高性能
Product Description	Protein Function:： Tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B), also known as Tumor necrosis factor receptor 2 (TNFR2) or CD120b antigen, is a member of the tumor necrosis factor receptor superfamily. TNFR2/CD120b/TNFRSF1B is a member of the TNF-receptor superfamily. This protein and TNF-receptor 1 form a heterocomplex that mediates the recruitment of two anti-apoptotic proteins, c-IAP1 and c-IAP2, which possess E3 ubiquitin ligase activity. Knockout studies in mice also suggest a role of this protein in protecting neurons from apoptosis by stimulating antioxidative pathways. TNFR2/CD120b/TNFRSF1B is not a major contributing factor to the genetic risk of type 2 diabetes, its associated peripheral neuropathy and hypertension and related metabolic traits in North Indians. Tumor necrosis factor receptor superfamily, member 1B (TNFRSF1B) has been reported to be associated with SLE risk in Japanese populations. TNFR2/CD120b/TNFRSF1B serves as a receptor with high affinity for TNFSF2 and approximately 5-fold lower affinity for homotrimeric TNFSF1. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, High performance, ≥95%(SDS-PAGE)
Bioactivity	Measured by its ability to inhibit TNF-α mediated cytotoxicity in L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D (A113142). The ED50 for this effect is typically 25.25 ng/mL in the presence of 1.0 ng/mL Recombinant
Endotoxin Concentration	<1 EU/μg
Expression System	HEK293
Amino Acids	1-257 aa
Sequence	MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGST
Protein Tag	C-hFc
Predicted molecular weight	51.5 kDa
SDS-PAGE	60.5-83.3 kDa, under reducing conditions; 119.3-183.3 kDa, under non-reducing conditions

Images

Recombinant Human TNF RII/TNFRSF1B Protein (rp179793) - Protein Bioactivity

Measured by its ability to inhibit TNF-α mediated cytotoxicity in L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D (A113142). The ED₅₀ for this effect is typically 25.25 ng/mL in the presence of 1.0 ng/mL Recombinant Human TNF-α (rp156007).

Recombinant Human TNF RII/TNFRSF1B Protein (rp179793) - SDS-PAGE
3 μg/lane of Recombinant Human TNF RII/TNFRSF1B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 60.5-83.3 kDa under reducing conditions and 119.3-183.3 kDa under non-reducing conditions.

Product Specifications

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

1 results found

Lot Number	Certificate Type	Date	Item
ZJ24R0700809	Certificate of Analysis	Jul 19, 2024	rp179793

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.