| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp152522-5μg | 5μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $59.90 | |
| rp152522-20μg | 20μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp152522-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $449.90 | |
| rp152522-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Carrier Free, >95%(SDS-PAGE), Active, E.coli, His&GST, 298-441aa
| Product Name | Recombinant Human TNF RII/TNFRSF1B Protein, ＞95%(SDS-PAGE), high purityused for Cell culture, Activity Assays, ELISA, SDS-PAGE various applications |
|---|---|
| Synonyms | CD120b antigen; CD120b; Etanercept; p75 TNF receptor; p75TBPII; p75TNFR; soluble TNFR1B variant 1; TNF RII; TNFBRp80 TNF-alpha receptor; TNF-R2; TNFR2TNFR1B; TNF-R75; TNFR80; TNFRII; TNF-RII; TNF-R-II; TNFR-II; TNFRSF1B; tumor necrosis factor beta recepto |
| Grade | ActiBioPure™, Azide Free, Bioactive, Carrier Free, Low Endotoxin |
| Product Description | Purity >95% SDS-PAGE. Function Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity. |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, Low Endotoxin, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | The binding activity of TNFRSF1B and TNFa, the EC50 was 0.0470~0.085 μg/ml. |
| Endotoxin Concentration | <1 EU/mg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 298-441 aa |
| Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKF |
| Protein Tag | N-His & GST |
| Protein Length | Protein fragment |
| Accession # | P20333 |
| Source | Recombinant |
| Predicted molecular weight | 44.8 kDa |
Recombinant Human TNF RII/TNFRSF1B Protein (rp152522)-Protein Bioactivity
Measured by its binding ability in a functional ELISA.Tumor Necrosis Factor Alpha (TNF-α) has been identified as an interactor of TNFRSF1B, thus a functional binding ELISA assay was conducted to detect the interaction of recombinant human TNFRSF1B and recombinant human TNF-α.
Recombinant Human TNF RII/TNFRSF1B Protein (rp152522)-SDS-PAGE
3μg/lane of Recombinant Human VCAM1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 51.3 kDa under reducing conditions and 49 kDa under non-reducing conditions.
| Application | Cell culture, Activity Assays, ELISA, SDS-PAGE |
|---|---|
| Form | Lyophilized |
| Reconstitution | Reconstitute in ddH2O to a concentration ≤0.1mg/mL. Do not vortex. |
| Storage Temp | Store at -80°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Avoid repeated freeze/thaw cycles. Store at 2-8℃ for one month. Aliquot and store at -80℃ for 12 months. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600460 | Certificate of Analysis | Jun 30, 2023 | rp152522 |
| ZJ23F0600461 | Certificate of Analysis | Jun 30, 2023 | rp152522 |
| ZJ23F0600462 | Certificate of Analysis | Jun 30, 2023 | rp152522 |
| 1. Pennica, D D and 7 more authors.. (1992) Biochemical properties of the 75-kDa tumor necrosis factor receptor. Characterization of ligand binding, internalization, and receptor phosphorylation.. The Journal of biological chemistry, (15): [PMID:1328224] |
| 2. Dembic, Z Z and 7 more authors.. (1990) Two human TNF receptors have similar extracellular, but distinct intracellular, domain sequences.. Cytokine, [PMID:1966549] |
| 3. Engelmann, H H, Novick, D D and Wallach, D D.. (1990) Two tumor necrosis factor-binding proteins purified from human urine. Evidence for immunological cross-reactivity with cell surface tumor necrosis factor receptors.. The Journal of biological chemistry, (25): [PMID:2153136] |
| 4. Smith, C A CA and 8 more authors.. (1990) A receptor for tumor necrosis factor defines an unusual family of cellular and viral proteins.. Science (New York, N.Y.), (25): [PMID:2160731] |
| 5. Heller, R A RA and 5 more authors.. (1990) Complementary DNA cloning of a receptor for tumor necrosis factor and demonstration of a shed form of the receptor.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2166946] |
| 6. Kohno, T T and 8 more authors.. (1990) A second tumor necrosis factor receptor gene product can shed a naturally occurring tumor necrosis factor inhibitor.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:2172983] |
| 7. Loetscher, H H and 5 more authors.. (1990) Purification and partial amino acid sequence analysis of two distinct tumor necrosis factor receptors from HL60 cells.. The Journal of biological chemistry, (25): [PMID:2173696] |
| 8. Suzuki, J J and 5 more authors.. (1994) Purification of two types of TNF inhibitors in the urine of the patient with chronic glomerulonephritis.. Nephron, [PMID:8015639] |
| 9. Rothe, M M, Wong, S C SC, Henzel, W J WJ and Goeddel, D V DV.. (1994) A novel family of putative signal transducers associated with the cytoplasmic domain of the 75 kDa tumor necrosis factor receptor.. Cell, (26): [PMID:8069916] |
| 10. Beltinger, C P CP and 9 more authors.. (1996) Physical mapping and genomic structure of the human TNFR2 gene.. Genomics, (1): [PMID:8661109] |
| 11. Park, Y C YC, Burkitt, V V, Villa, A R AR, Tong, L L and Wu, H H.. (1999) Structural basis for self-association and receptor recognition of human TRAF2.. Nature, (8): [PMID:10206649] |
| 12. Tsuchiya, N N, Komata, T T, Matsushita, M M, Ohashi, J J and Tokunaga, K K.. (2000) New single nucleotide polymorphisms in the coding region of human TNFR2: association with systemic lupus erythematosus.. Genes and immunity, [PMID:11197692] |
| 13. Morita, C C and 10 more authors.. (2001) Association of tumor necrosis factor receptor type II polymorphism 196R with Systemic lupus erythematosus in the Japanese: molecular and functional analysis.. Arthritis and rheumatism, [PMID:11762942] |
| 14. Peral, Belén B, San Millán, José L JL, Castello, Roberto R, Moghetti, Paolo P and Escobar-Morreale, Héctor F HF.. (2002) Comment: the methionine 196 arginine polymorphism in exon 6 of the TNF receptor 2 gene (TNFRSF1B) is associated with the polycystic ovary syndrome and hyperandrogenism.. The Journal of clinical endocrinology and metabolism, [PMID:12161545] |
| 15. Pan, Shi S and 5 more authors.. (2002) Etk/Bmx as a tumor necrosis factor receptor type 2-specific kinase: role in endothelial cell migration and angiogenesis.. Molecular and cellular biology, [PMID:12370298] |
| 16. Lainez, Begoña B and 6 more authors.. (2004) Identification and characterization of a novel spliced variant that encodes human soluble tumor necrosis factor receptor 2.. International immunology, [PMID:14688072] |
| 17. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414] |
| 18. Zhou, Houjiang H and 6 more authors.. (2013) Toward a comprehensive characterization of a human cancer cell phosphoproteome.. Journal of proteome research, (4): [PMID:23186163] |
