| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145269-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp145269-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp145269-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $239.90 | |
| rp145269-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,989.90 |
Animal Free, >97% (SDS-PAGE&HPLC), Active, E.coli, No tag, 52-183 aa
| Product Name | Recombinant Human TRAIL R2/TNFRSF10B Protein, >97% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | CD262 antigen; CD262; death domain containing receptor for TRAIL/Apo-2L; Death receptor 5; DR5; DR5TRICK2B; Fas-like protein; KILLER/DR5; KILLERapoptosis inducing protein TRICK2A/2B; TNF-related apoptosis-inducing ligand receptor 2; TNFRSF10B; TRAIL R2; T |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥97%(SDS-PAGE&HPLC) |
| Purity | >97% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. rHusTRAIL-R2 reduced the production of LPS-induced TNF by its ability to neutralize endogenous TRAIL in fresh human PBMC. In this assay, endogenous TRAIL is induced during a 24 hour exposure to LPS (10 |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 52-183 aa |
| Sequence | ESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES |
| Protein Tag | No tag |
| Predicted molecular weight | 14.8 kDa |
| SDS-PAGE | 14.8 kDa |
Recombinant Human TRAIL R2/TNFRSF10B Protein (rp145269) - SDS-PAGE
Recombinant Human TRAIL R2/TNFRSF10B Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining. Showing a single band at 16.3 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1001340 | Certificate of Analysis | Oct 19, 2023 | rp145269 |
| ZJ23F1001341 | Certificate of Analysis | Oct 19, 2023 | rp145269 |
| ZJ23F1001342 | Certificate of Analysis | Oct 19, 2023 | rp145269 |
| 1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] |
| 2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334] |
| 3. Ohtsuki T, Kikuchi H, Koyano T, Kowithayakorn T, Sakai T, Ishibashi M.. (2009) Death receptor 5 promoter-enhancing compounds isolated from Catimbium speciosum and their enhancement effect on TRAIL-induced apoptosis.. Bioorg Med Chem, 17 (18): (6748-6754). [PMID:19682913] |
| 4. Kikuchi H, Ohtsuki T, Koyano T, Kowithayakorn T, Sakai T, Ishibashi M.. (2010) Activity of mangosteen xanthones and teleocidin a-2 in death receptor expression enhancement and tumor necrosis factor related apoptosis-inducing ligand assays.. J Nat Prod, 73 (3): (452-455). [PMID:19788289] |
| 5. Pan, G G and 5 more authors.. (1997) An antagonist decoy receptor and a death domain-containing receptor for TRAIL.. Science (New York, N.Y.), (8): [PMID:9242610] |
| 6. Sheridan, J P JP and 12 more authors.. (1997) Control of TRAIL-induced apoptosis by a family of signaling and decoy receptors.. Science (New York, N.Y.), (8): [PMID:9242611] |
| 7. Screaton, G R GR and 5 more authors.. (1997) TRICK2, a new alternatively spliced receptor that transduces the cytotoxic signal from TRAIL.. Current biology : CB, (1): [PMID:9285725] |
| 8. Walczak, H H and 11 more authors.. (1997) TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL.. The EMBO journal, (1): [PMID:9311998] |
| 9. MacFarlane, M M and 5 more authors.. (1997) Identification and molecular cloning of two novel receptors for the cytotoxic ligand TRAIL.. The Journal of biological chemistry, (10): [PMID:9325248] |
| 10. Wu, G S GS and 14 more authors.. (1997) KILLER/DR5 is a DNA damage-inducible p53-regulated death receptor gene.. Nature genetics, [PMID:9326928] |
| 11. Schneider, P P and 5 more authors.. (1997) Characterization of two receptors for TRAIL.. FEBS letters, (27): [PMID:9373179] |
| 12. Chaudhary, P M PM and 5 more authors.. (1997) Death receptor 5, a new member of the TNFR family, and DR4 induce FADD-dependent apoptosis and activate the NF-kappaB pathway.. Immunity, [PMID:9430227] |
| 13. Arai, T T and 5 more authors.. (1998) Genomic organization and mutation analyses of the DR5/TRAIL receptor 2 gene in colorectal carcinomas.. Cancer letters, (27): [PMID:10072170] |
| 14. Mongkolsapaya, J J and 6 more authors.. (1999) Structure of the TRAIL-DR5 complex reveals mechanisms conferring specificity in apoptotic initiation.. Nature structural biology, [PMID:10542098] |
| 15. Hymowitz, S G SG and 7 more authors.. (1999) Triggering cell death: the crystal structure of Apo2L/TRAIL in a complex with death receptor 5.. Molecular cell, [PMID:10549288] |
| 16. Hillman, R Tyler RT, Green, Richard E RE and Brenner, Steven E SE.. (2004) An unappreciated role for RNA surveillance.. Genome biology, [PMID:14759258] |
| 17. Yamaguchi, Hirohito H and Wang, Hong-Gang HG.. (2004) CHOP is involved in endoplasmic reticulum stress-induced apoptosis by enhancing DR5 expression in human carcinoma cells.. The Journal of biological chemistry, (29): [PMID:15322075] |
| 18. Nusbaum, Chad C and 75 more authors.. (2006) DNA sequence and analysis of human chromosome 8.. Nature, (19): [PMID:16421571] |
| 19. Maddipatla, Sreeram S, Hernandez-Ilizaliturri, Francisco J FJ, Knight, Joy J and Czuczman, Myron S MS.. (2007) Augmented antitumor activity against B-cell lymphoma by a combination of monoclonal antibodies targeting TRAIL-R1 and CD20.. Clinical cancer research : an official journal of the American Association for Cancer Research, (1): [PMID:17671142] |
| 20. Bechtel, Stephanie S and 18 more authors.. (2007) The full-ORF clone resource of the German cDNA Consortium.. BMC genomics, (31): [PMID:17974005] |
| 21. Sun, M M, Song, L L, Li, Y Y, Zhou, T T and Jope, R S RS.. (2008) Identification of an antiapoptotic protein complex at death receptors.. Cell death and differentiation, [PMID:18846110] |
| 22. Smith, Wendell W and 17 more authors.. (2013) Human cytomegalovirus glycoprotein UL141 targets the TRAIL death receptors to thwart host innate antiviral defenses.. Cell host & microbe, (13): [PMID:23498957] |
| 23. Nemčovičová, Ivana; Benedict, Chris A and Zajonc, Dirk M.. (2013) Structure of human cytomegalovirus UL141 binding to TRAIL-R2 reveals novel, non-canonical death receptor interactions.. PLoS pathogens, [PMID:23555243] |
| 24. Newson, Joshua P M and 11 more authors.. (2019) Salmonella Effectors SseK1 and SseK3 Target Death Domain Proteins in the TNF and TRAIL Signaling Pathways.. Molecular & cellular proteomics : MCP, [PMID:30902834] |
