| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145031-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $109.90 | |
| rp145031-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp145031-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $429.90 | |
| rp145031-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,199.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 56-211 aa
| Product Name | Recombinant Human TRAILR4/TNFRSF10D Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD264 antigen | CD264 | DcR2 | DCR2decoy with truncated death domain | Decoy receptor 2 | TNF receptor-related receptor for TRAIL | TNF-related apoptosis-inducing ligand receptor 4 | TNFRSF10D | TRAIL R4 | TRAILR4 | TRAIL-R4 | TRAILR4TRAIL receptor 4 | TR |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL. The ED50 for this effect is 1.8-7.2 ng/mL in the presence of 20 ng/mL Recombinant Human TRAIL/TNFSF10. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 56-211 aa |
| Sequence | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYHENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL |
| Protein Tag | C-hFc & His |
| Accession # | Q9UBN6 |
| Predicted molecular weight | 44 kDa |
| SDS-PAGE | 60.0 - 70.0 kDa, under reducing conditions; 120.0 - 140.0 kDa, under non-reducing conditions. |
Recombinant Human TRAILR4/TNFRSF10D Protein (rp145031) - Protein Bioactivity
Measured by its ability to inhibit TRAIL mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL.
The ED₅₀
for this effect is 7.5 ng/mL in the presence of 20 ng/mL TRAIL.
Recombinant Human TRAILR4/TNFRSF10D Protein (rp145031) - SDS-PAGE
3 μg/lane of Recombinant Human TRAILR4/TNFRSF10D Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 60.0 - 70.0 kDa under reducing conditions and 60.0 - 70.0 & 120.0 - 140.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404963 | Certificate of Analysis | Apr 30, 2024 | rp145031 |
| ZJ24F0404962 | Certificate of Analysis | Apr 30, 2024 | rp145031 |
| ZJ24F0404961 | Certificate of Analysis | Apr 30, 2024 | rp145031 |
| 1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] |
| 2. Marsters, S A SA and 10 more authors.. (1997) A novel receptor for Apo2L/TRAIL contains a truncated death domain.. Current biology : CB, (1): [PMID:9382840] |
| 3. Degli-Esposti, M A MA and 5 more authors.. (1997) The novel receptor TRAIL-R4 induces NF-kappaB and protects against TRAIL-mediated apoptosis, yet retains an incomplete death domain.. Immunity, [PMID:9430226] |
| 4. Pan, G G, Ni, J J, Yu, G G, Wei, Y F YF and Dixit, V M VM.. (1998) TRUNDD, a new member of the TRAIL receptor family that antagonizes TRAIL signalling.. FEBS letters, (6): [PMID:9537512] |
| 5. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
