| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp181615-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp181615-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp181615-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp181615-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), 293F cell, C-His tag, 1-303 aa
| Product Name | Recombinant Human uPAR Protein |
|---|---|
| Grade | Animal Free, Carrier Free |
| Product Description | Protein Function:： |
| Specifications & Purity | Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-303 aa |
| Sequence | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKN |
| Protein Tag | C-His |
| Predicted molecular weight | 32.1 kDa |
| SDS-PAGE | 47.4 kDa, under reducing conditions; 45.9 kDa, under non-reducing conditions |
Recombinant Human uPAR Protein (rp181615) - SDS-PAGE
3 μg/lane of Recombinant Human uPAR Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 47.4 kDa under reducing conditions and 45.9 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708279 | Certificate of Analysis | Jul 17, 2024 | rp181615 |
| ZJ24F0708278 | Certificate of Analysis | Jul 17, 2024 | rp181615 |
| ZJ24F0708277 | Certificate of Analysis | Jul 17, 2024 | rp181615 |
