| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp184119-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp184119-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp184119-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp184119-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, ≥90% (SDS-PAGE), Active, 293F cell, C-His tag, 1-593 aa
| Product Name | Recombinant Human VE-Cadherin Protein |
|---|---|
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, 高性能 |
| Product Description |
Cadherins (Calcium dependent adhesion molecules) are a class of transmembrane proteins. Cadherin-5, also known as VE-cadherin, CDH5 and CD144, an endothelial specific cell-cell adhesion molecule, plays a pivotal role in the formation, maturation and remodeling of the vascular wall. VE-Cadherin is widely considered to be specific for vascular endothelia in which it is either the sole or the predominant cadherin, often co-existing with N-cadherin. This specificity of VE-cadherin for vascular endothelial cells is important not only in blood and lymph vessel biology and medicine, but also for cell-type-based diagnoses, notably those of metastatic tumors. As a classical cadherin, VE-Cadherin links endothelial cells together by homophilic interactions mediated by its extracellular part and associates intracellularly with the actin cytoskeleton via catenins. Mechanisms that regulate VE-cadherin-mediated adhesion are important for the control of vascular permeability and leukocyte extravasation. In addition to its adhesive functions, VE-Cadherin regulates various cellular processes such as cell proliferation and apoptosis and modulates vascular endothelial growth factor receptor functions. Consequently, VE-cadherin is essential during embryonic angiogenesis.
|
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, High performance, ≥90%(SDS-PAGE) |
| Bioactivity | Measured by the ability of the immobilized protein to support the adhesion of HUVEC cells. The ED50 for this effect is 308.4ng/mL. Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cel |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-593 aa |
| Sequence | MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADDPTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSGTATVLVTLQDINDNF |
| Protein Tag | C-His |
| Predicted molecular weight | 67.5 kDa |
| SDS-PAGE | 82.0-98.0 kDa, under reducing conditions; 82.0-98.0 kDa, under non-reducing conditions |
Recombinant Human VE-Cadherin Protein (rp184119) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of HUVEC cells. The ED50 for this effect is 308.4 ng/mL.
Recombinant Human VE-Cadherin Protein (rp184119) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of HUVEC human umbilical vein endothelial cells, When 3 x 104 cells per well are added to Recombinant Human VE-Cadherin Protein (rp184119) coated plates (370 ng/mL, 100 μL/well) can significantly improve cells adhesion.
Recombinant Human VE-Cadherin Protein (rp184119) - SDS-PAGE
3 μg/lane of Recombinant Human VE-Cadherin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 82.0-98.0 kDa.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
