| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp155965-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $189.90 | |
| rp155965-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $459.90 | |
| rp155965-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $769.90 | |
| rp155965-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
GMP, ≥95% (SDS-PAGE), Active, Oryza sativa, No tag, 27-191 aa
| Product Name | Recombinant Human VEGF Protein, ＞95%(SDS-PAGE), high purity, CAS No.127464-60-2 |
|---|---|
| Synonyms | MVCD1; VAS; Vascular endothelial growth factor A; Vascular permeability factor; Vasculotropin; VEGF; VEGFA; VEGF-A; VEGFMGC70609; VPF; VPFvascular endothelial growth factor; OsrhVEGF; Recombinant Human Vascular Endothelial Growth Factor from Oryza sativa |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, High performance |
| Product Description | VEGF permeability factor, also known as Vascular permeability factor (VPF), is a highly specific permeability factor for endothelial growth factor. It can promote the increase of vascular permeability, extracellular matrix degeneration, vascular endothelial cell migration, proliferation and angiogenesis. VEGF has also been shown to have chemotaxis on monocytes and osteoblasts.OsrhVEGF is expressed by oryza sativa and purified by protein purification technology. |
| Specifications & Purity | GMP, Bioactive, ActiBioPure™, High performance, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Biochemical and Physiological Mechanisms | Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 re |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | The ED50 value was lower than 10.0 ng/ml, that is, the corresponding active unit was greater than or equal to 1 x 10^5 units/mg by primary HUVECs cell proliferation method. |
| Endotoxin Concentration | <0.2 EU/μg |
| Expression System | Oryza sativa |
| Species | Human |
| Amino Acids | 27-191 aa |
| Sequence | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P15692-4 |
| Source | Recombinant |
| Predicted molecular weight | 19.2 kDa |
| SDS-PAGE | 19.2 kDa |
Recombinant Human VEGF Protein (rp155965)-Protein Bioactivity
Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is typically <10ng/mL.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 100-200 μg/mL. Stock solutions should be stored at 4℃ for 2-7days, stored at -20℃ for lo |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20℃ for 3 years. Upon delivery aliquot. Avoid freeze/thaw cycle. |
| CAS | 127464-60-2 |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600447 | Certificate of Analysis | Jun 30, 2023 | rp155965 |
| ZJ23F0600446 | Certificate of Analysis | Jun 30, 2023 | rp155965 |
| ZJ23F0600445 | Certificate of Analysis | Jun 30, 2023 | rp155965 |
