| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp153562-10μg | 10μg | In stock | $139.90 | |
| rp153562-50μg | 50μg | In stock | $379.90 | |
| rp153562-100μg | 100μg | In stock | $609.90 | |
| rp153562-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,079.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F, His tag, 18-247aa
| Product Name | Recombinant Mouse Adiponectin/Acrp30 Protein, ＞95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | ACDC; Acrp30; ACRP30ADPN; adipocyte, C1Q and collagen domain containing; Adiponectin; adiponectin, C1Q and collagen domain containing; AdipoQ; ADIPQTL1; ApM1; apM-1; APM1APM-1; C1q and collagen domain-containing protein; GBP28; GBP28apM1; Gelatin-binding |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity >95% SDS-PAGE. Function Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. Post-translational Hydroxylated Lys-33 was not identified in PubMed:16497731, probably due to poor representation of the N-terminal peptide in mass fingerprinting. HMW complexes are more extensively glycosylated than smaller oligomers. Hydroxylation and glycosylation of the lysine residues within the collagene-like domain of adiponectin seem to be critically involved in regulating the formation and/or secretion of HMW complexes and consequently contribute to the insulin-sensitizing activity of adiponectin in hepatocytes. O-glycosylated. Not N-glycosylated. O-linked glycans on hydroxylysines consist of Glc-Gal disaccharides bound to the oxygen atom of post-translationally added hydroxyl groups. Sialylated to varying degrees depending on tissue. Thr-22 appears to be the major site of sialylation. Higher sialylation found in SGBS adipocytes than in HEK fibroblasts. Sialylation is not required neither for heterodimerization nor for secretion. Not sialylated on the glycosylated hydroxylysines. Desialylated forms are rapidly cleared from the circulation. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95% (SDS-PAGE) |
| Bioactivity | Measured by its ability to induce TIMP-1 secretion by mouse macrophages. Kumada. The ED₅₀ for this effect is 5-20 μg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 18-247 aa |
| Sequence | EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNHHHHHH |
| Protein Tag | C-His |
| Accession # | Q60994 |
| Predicted molecular weight | 25 kDa |
Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562) - Protein Bioactivity
Fully biologically active determined by the dose dependent increase in MCF7 cell proliferation. The ED₅₀ for this effect is 0.17 μg/mL. Adiponectin induces a dichotomic effect on breast cancer growth. It stimulates growth in ERα+ MCF-7 cells while inhibiting proliferation of ERα- MDA-MB-231 cells.
Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562) - Protein Bioactivity
Measured by its ability to induce TIMP-1 secretion by mouse macrophages. The ED50 for this effect is 5-20 μg/mL.
Recombinant Mouse Adiponectin/Acrp30 Protein (rp153562) - SDS-PAGE
4 μg/lane of Recombinant Mouse Adiponectin/Acrp30 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 31.4 kDa under reducing conditions and 30.2 & 54.1 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101635 | Certificate of Analysis | Nov 27, 2023 | rp153562 |
| ZJ23F1101636 | Certificate of Analysis | Nov 27, 2023 | rp153562 |
| ZJ23F1101637 | Certificate of Analysis | Nov 27, 2023 | rp153562 |
