My Cart
You have no items in your shopping cart.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp153668-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
rp153668-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $559.90 | |
rp153668-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $899.90 | |
rp153668-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,899.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-10*His tag, 18-339 aa
Product Name | Recombinant Mouse Cathepsin B Protein |
---|---|
Synonyms | APP secretase | APPS | Cathepsin B | Cathepsin B1 | CPSBamyloid precursor protein secretase | CTSB | cysteine protease | EC 3.4.22 | EC 3.4.22.1 | CPSB | CB | Preprocathepsin B |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
Product Description | Function |
Specifications & Purity | Animal Free, Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE) |
Bioactivity | Measured by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC. The specific activity is >2,000 pmol/min/µg, as measured under the described conditions. |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | HEK293 |
Species | Mouse |
Amino Acids | 18-339 aa |
Sequence | HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFHHHHHHHHHH |
Protein Tag | C-10His |
Accession # | P10605 |
Predicted molecular weight | 37 kDa |
SDS-PAGE | 43 kDa, under reducing conditions |
Form | Liquid |
---|---|
Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |