| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp153705-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp153705-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $309.90 | |
| rp153705-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $529.90 | |
| rp153705-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,079.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, Fc&His tag, 1-188 aa
| Product Name | Recombinant Mouse CD137 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | 4-1BB ligand receptor; 41BB; 4-1BB; CD137 antigen; CD137; CD137MGC2172; CDw137; FLJ43501; ILA; ILAhomolog of mouse 4-1BB; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; receptor protein 4-1BB; T cell antigen |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >95% SDS-PAGE Function Receptor for TNFSF14/4-1BBL. Possibly active during T cell activation. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse T cells. The ED50 for this effect is 0.3-1 ug/mL in the presence of 0.4 ug/mL of recombinant mouse 4-1BBL |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 1-188 aa |
| Sequence | VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYELENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK |
| Protein Tag | C-Fc & His |
| Accession # | Q8R037 |
| Predicted molecular weight | 48 kDa |
| SDS-PAGE | 65.4 kDa, under reducing conditions; 133.8 & 60.7 kDa, under non-reducing conditions. |
Recombinant Mouse CD137 Protein (rp153705) - Protein Bioactivity
Measured by its ability to block 4-1BBL-induced IL-2 secretion by mouse T cells. The ED₅₀ for this effect is 0.3-1.0 µg/mL in the presence of 0.4 µg/mL of recombinant mouse 4-1BBL.
Recombinant Mouse CD137 Protein (rp153705) - SDS-PAGE
3 μg/lane of Recombinant Mouse CD137 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 65.4 kDa under reducing conditions and 133.8 & 60.7 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505769 | Certificate of Analysis | May 24, 2024 | rp153705 |
| ZJ24F0505768 | Certificate of Analysis | May 24, 2024 | rp153705 |
| ZJ24F0505767 | Certificate of Analysis | May 24, 2024 | rp153705 |
