| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp153710-2μg | 2μg | In stock | $59.90 | |
| rp153710-10μg | 10μg | In stock | $139.90 | |
| rp153710-100μg | 100μg | In stock | $369.90 | |
| rp153710-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,269.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, Fc&His, 18-345aa
| Product Name | Recombinant Mouse CD14 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | CD 14; CD_antigen=CD14; CD14; CD14 antigen; CD14 molecule; CD14_HUMAN; LPS-R; Mo2; Monocyte differentiation antigen CD14; Monocyte differentiation antigen CD14 urinary form; Monocyte differentiation antigen CD14, membrane-bound form; Myeloid cell specifi |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity >90% SDS-PAGE. Additional sequence information This product is for the mature full length protein. The signal peptide is not included. NP_033971 Function Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules. Post-translational N- and O- glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED50 for this effect is 0.4-2.4 µg/mL. |
| Endotoxin Concentration | ＜0.01 EU/μg |
| Expression System | HEK293 |
| Species | Mouse |
| Amino Acids | 18-345 aa |
| Sequence | APPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQL |
| Protein Tag | C-Fc & His |
| Accession # | Q4FJP7 |
| Predicted molecular weight | 62 kDa |
Recombinant Mouse CD14 Protein (rp153710) - Protein Bioactivity
Measured by its ability to enhance LPS-induced IL-6 secretion by mouse splenocytes. The ED₅₀ for this effect is 2.2 µg/mL.
Recombinant Mouse CD14 Protein (rp153710) - SDS-PAGE
2 μg/lane of Recombinant Mouse CD14 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 85.5 kDa under reducing conditions and 195.7 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, -20 to -70 ℃ under sterile conditions after reconstitution. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101731 | Certificate of Analysis | Nov 20, 2023 | rp153710 |
| ZJ23F1101730 | Certificate of Analysis | Nov 20, 2023 | rp153710 |
| ZJ23F1101729 | Certificate of Analysis | Nov 20, 2023 | rp153710 |
