| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp153970-5μg | 5μg | In stock | $89.90 | |
| rp153970-50μg | 50μg | In stock | $399.90 | |
| rp153970-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,399.90 | |
| rp153970-500μg | 500μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
Animal Free, >96%(SDS-PAGE, HPLC), Active, E.coli, No tag, 29-210 aa
| Product Name | Recombinant Mouse FGF-21 Protein, ＞96%(SDS-PAGE, HPLC), high purity |
|---|---|
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Fibroblast growth factor-21 (FGF-21) belongs to the large FGF family and it is specifically induced by HMGCS2 activity. In mice, brown adipose tissue becomes a source of systemic FGF21 after cold exposure. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression and the activity depends on the presence of KLB. FGF-21, in the presence of β-Klotho as a protein cofactor, signals through the FGFR 1c and 4 receptors. Murine FGF-21 shows limited binding to heparin. In addition, Murine FGF-21 respectively shows 81% and 92% a.a. identity to human and rat FGF-21, and it show activity on human and rat cells. Recombinant Murine FGF21 is a 19.9kDa globular protein containing 182 amino acid residues. Purity >96%(SDS-PAGE, HPLC) Additional sequence information A single non-glycosylated polypeptide chain containing 182 amino acids. This product is for the mature full length protein. The signal peptide is not included. Function Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥96%(SDS-PAGE&HPLC) |
| Purity | ＞96%(SDS-PAGE, HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED₅₀ as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2.0 ×10³IU/mg in the presence of 5 µg/ml of r |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | E.coli |
| Species | Mouse |
| Amino Acids | 29-210 aa |
| Sequence | AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRS PESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFREL LLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEP QDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
| Protein Tag | No tag |
| Accession # | Q9JJN1 |
| Predicted molecular weight | 19.9 kDa |
Recombinant Mouse FGF-21 Protein (rp153970) - Protein Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/mL, corresponding to a specific activity of > 2.0 X 10³ IU/mg in the presence of 5.0 µg/mL of rMuβ-Klotho and 10.0 μg/mL of heparin.
Recombinant Mouse FGF-21 Protein (rp153970) - SDS-PAGE
3 μg/lane of Recombinant Mouse FGF-21 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 21.1 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40 Constituent: 100% PBS Lyophilized from a 0.2 µm filtered concentrated solution in 3 脳 PBS. This product is an active |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101656 | Certificate of Analysis | Nov 20, 2023 | rp153970 |
| ZJ23F1101655 | Certificate of Analysis | Nov 20, 2023 | rp153970 |
