| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp153964-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $66.90 | |
| rp153964-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $210.90 | |
| rp153964-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,806.90 |
Animal Free, >98%(SDS-PAGE), Active, E.coli, His, 11-154aa
| Product Name | Recombinant Mouse FGF basic/FGF2/bFGF Protein, ＞98%(SDS-PAGE), high purity |
|---|---|
| Synonyms | basic fibroblast growth factor bFGF; Basic fibroblast growth factor; bFGF; FGF basic; FGF2; FGF-2; FGFBprostatropin; fibroblast growth factor 2 (basic); HBGF-2; heparin-binding growth factor 2; Prostatropin |
| Grade | Animal Free, Azide Free, Carrier Free |
| Product Description | FGF2, also known as a basic fibroblast growth factor (bFGF) and FGF-β, is a growth factor and signaling protein encoded by the FGF2 gene. FGF2 has been shown in preliminary animal studies to protect the heart from injury associated with a heart attack, reducing tissue death and promoting improved function after reperfusion. FGF-2 (bFGF) are also involved in a variety of biological processes, including embryonic development, morphogenesis, tissue repair, tumor growth, and invasion. Additionally, FGF-2 (bFGF) is frequently used for a critical component of cell culture medium, e.g., human embryonic stem cell culture medium, serum-free culture systems. |
| Specifications & Purity | Animal Free, Carrier Free, Azide Free, ≥98%(SDS-PAGE) |
| Purity | ＞98%(SDS-PAGE) |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Species | Mouse |
| Amino Acids | 11-154 aa |
| Sequence | ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein Tag | N-His |
| N-terminal Sequence | His |
| Accession # | P15655 |
| Predicted molecular weight | 17.2 kDa |
| SDS-PAGE | 17.2 kDa, under reducing conditions; 17.2 kDa, under non-reducing conditions. |
Recombinant Mouse FGF basic/FGF2/bFGF (rp153964) - SDS-PAGE
3 μg/lane of Recombinant Mouse FGF basic/FGF2/bFGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 17.2 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage Temp | Store at -80°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1%BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0800926 | Certificate of Analysis | Aug 30, 2023 | rp153964 |
| ZJ23F0800927 | Certificate of Analysis | Aug 30, 2023 | rp153964 |
