| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154139-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $179.90 | |
| rp154139-20μg | 20μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $279.90 | |
| rp154139-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $999.90 | |
| rp154139-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,459.90 |
Animal free, ＞98%(SDS-PAGE,HPLC), Active, E.coli, No tag, 21-131 aa
| Product Name | Recombinant Mouse IL-13 Protein, ＞98%(SDS-PAGE,HPLC), high purity |
|---|---|
| Synonyms | Allergic rhinitis; ALRH; BHR 1; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; IL-13; Il13; IL13_HUMAN; Interleukin 13; Interleukin-13; interleukin13; MGC116786; MGC116788; MGC116789; NC 30; NC30; P 600; P60 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Murine Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 11 and secreted by many cell types, especially T helper type 2 (Th2) cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching, resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human, mouse and rat IL-13 share low homology, but have cross species activity. Recombinant Murine IL-13 is a 12.3kDa protein consisting of 111 amino acid residues Purity ＞98%(SDS-PAGE,HPLC) Function Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses . Positively regulates IL31RA expression in macrophages. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | ＞98%(SDS-PAGE,HPLC) |
| Bioactivity | Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL. |
| Endotoxin Concentration | ＜0.01 EU/μg |
| Expression System | E.coli |
| Species | Mouse |
| Amino Acids | 22-131 aa |
| Sequence | MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGF CVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHF ITKLLSYTKQLFRHGPF |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P20109 |
| Source | Recombinant |
| Predicted molecular weight | 12.3 kDa |
Recombinant Mouse IL-13 Protein (rp154139)-Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is typically <4ng/mL.
Recombinant Mouse IL-13 Protein (rp154139)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-13 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 11.2 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | 1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2、 Reconstitute in a sterile aqueous buffer to an appropriate concentration. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | For long term storage, the product should be stored ≤ -20℃ . Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0400125 | Certificate of Analysis | Apr 29, 2023 | rp154139 |
| ZJ23F0400124 | Certificate of Analysis | Apr 29, 2023 | rp154139 |
