| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154200-2μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 2μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $78.90 | |
| rp154200-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $191.90 | |
| rp154200-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $697.90 | |
| rp154200-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $5,338.90 |
Animal Free, >97%(SDS-PAGE), Active, E.coli, No tag, 33-166aa
| Product Name | Recombinant Mouse IL-3 Protein, ＞97%(SDS-PAGE), high purity |
|---|---|
| Synonyms | Hematopoietic growth factor; IL3; IL-3; IL-3MGC79398; interleukin 3 (colony-stimulating factor, multiple); interleukin-3; Mast cell growth factor; mast-cell growth factor; MCGF; MCGFMGC79399; MULTI-CSF; multilineage-colony-stimulating factor; Multipotenti |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE) |
| Purity | ＞97%(SDS-PAGE) |
| Biological Activity | Measured in a cell proliferation assay using NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <100pg/mL. |
| Species | Mouse |
| Amino Acids | 33 to 166 |
| Sequence | DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Protein Length | Full length protein |
| Accession # | P01586 |
| Source | Recombinant |
| Predicted molecular weight | 15 kDa |
| SDS-PAGE | 16.5 kDa, under reducing conditions; 15.4 kDa, under non-reducing conditions. |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
Recombinant Mouse IL-3 Protein (rp154200)-Protein Bioactivity
Measured in a cell proliferation assay using NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <100pg/mL
Recombinant Mouse IL-3 Protein (rp154200)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-3 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.5 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute at 100 μg/mL in sterile PBS. |
| Storage Temp | Store at -20°C,Desiccated,Avoid repeated freezing and thawing |
| Shipped In | Dry ice |
| Stability And Storage | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -20 to -70℃ under sterile conditions after reconstitu |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0500155 | Certificate of Analysis | May 22, 2023 | rp154200 |
| ZJ23F0500156 | Certificate of Analysis | May 22, 2023 | rp154200 |
| ZJ23F0500157 | Certificate of Analysis | May 22, 2023 | rp154200 |
