| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp154200-2μg | 2μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $59.90 | |
| rp154200-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp154200-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $349.90 | |
| rp154200-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Animal Free, ≥97% (SDS-PAGE), Active, E.coli, No tag, 33-166 aa
| Product Name | Recombinant Mouse IL-3 Protein, ＞97%(SDS-PAGE), high purity |
|---|---|
| Synonyms | Hematopoietic growth factor | IL3 | IL-3 | IL-3MGC79398 | interleukin 3 (colony-stimulating factor, multiple) | interleukin-3 | Mast cell growth factor | mast-cell growth factor | MCGF | MCGFMGC79399 | MULTI-CSF | multilineage-colony-stimulating factor | |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance |
| Product Description |
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
|
| Specifications & Purity | Animal Free, Carrier Free, Bioactive, ActiBioPure™, High performance, ≥97%(SDS-PAGE) |
| Purity | ＞97%(SDS-PAGE) |
| Bioactivity | Measured in a cell proliferation assay using NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <100pg/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | E.coli |
| Species | Mouse |
| Amino Acids | 33-166 aa |
| Sequence | DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P01586 |
| Source | Recombinant |
| Predicted molecular weight | 15 kDa |
| SDS-PAGE | 16.5 kDa, under reducing conditions; 15.4 kDa, under non-reducing conditions. |
Recombinant Mouse IL-3 Protein (rp154200)-Protein Bioactivity
Measured in a cell proliferation assay using NFS‑60 mouse myelogenous leukemia lymphoblast cells. The ED₅₀ for this effect is typically <100pg/mL
Recombinant Mouse IL-3 Protein (rp154200)-SDS-PAGE
3μg/lane of Recombinant Mouse IL-3 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 16.5 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute at 100 μg/mL in sterile PBS. |
| Storage Temp | Store at -20°C,Desiccated,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70℃ as supplied. 1 month, 2 to 8℃ under sterile conditions after reconstitution. 3 months, -20 to -70℃ under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0500155 | Certificate of Analysis | May 22, 2023 | rp154200 |
| ZJ23F0500156 | Certificate of Analysis | May 22, 2023 | rp154200 |
| ZJ23F0500157 | Certificate of Analysis | May 22, 2023 | rp154200 |
